PNG  IHDRCIDATx1 7 89T5<'wq;`0`0qwq; wq;`0`0qwq;`;`0qw0q;w;`0`w0q;wq;`0`w0qwq;`;`0qwq;w;`0`w0q;w;`0`w0qwq;`0`0qwq;w;`0qw0q;w;`0`w0q;wq;`0`0qwq;`;`0qw0q;w;`0`w0q;wq;`0`w0qwq;``0qwq;w;`0`0qwq;w;`0`0qwq;w;`0qw0q;w;`0`w0q;wq;`0`0qwq;`;`0qw0q;w;`0`w0q;wq;`0`w0qwq;`;`0qwq;w;`0`w0q;w;`0`w0qwq;`0`0qwq;w;`0qw0q;w;`0`w0q;wq;`0`0qwq;`;`0qw0q;w;`0`w0q;wq;w;`0`w0q;wq;w;`0`w0q;w;`0`w0qwq;`0`0qwq;w;`0qw0q;w;`0`w0q;wq;`0`0qwq;`;`0qw0q;w;`0`w0q;wq;`0`w0qwq;`;`0qwq;w;`0`w0q;w;`0`w0qwq;`0`0qwq;w;`0qw0q;w;`K0`w0q;wq;`0`H0`w0q;wq;`0`H0`w0q;wq;`0`w0qwq;`;`0qwq;w;`0`w0q;w;`0`w0qwq;`0`0qwq;w;`0qw0q;w;`0`w0q;wq;`0`0qwq;`;`0qw0q;w;`0`w0q;wq;`0`w0qwq;`;`0qwq;w;`0`w0qdIENDB` FM / RemoteInstall
/usr/lib/Acronis/RemoteInstall
NameSizeModeActions
acroinst271079040755editdlrm
acroinst2.yaml8720644editdlrm
atp_tls_config.yaml1980644editdlrm
fips.so23745680644editdlrm
fipsmodule.cnf2280644editdlrm
libakk.so9142400755editdlrm
libcrypto.so.364329440644editdlrm
libcurl.so7858960755editdlrm
libssl.so.310979920644editdlrm
openssl9656560755editdlrm
openssl.cnf1730644editdlrm
openssl_fips.cnf4110644editdlrm
openssl_nofips.cnf1730644editdlrm
Edit: /usr/lib/Acronis/RemoteInstall/openssl (965656B)
ELF>sB@@8 @ @@@@@88@8@@@  NN` N NTT@T@DDPtd MMQtdRtd NN@ @ /lib64/ld-linux-x86-64.so.2GNUGNUR`3="A4sɼU2,>Xc~+:Jg5HViw2Ej )7LYkw+E`y1;Yr4Nh{*8Mbm   0 C K \ p        * B V i u        # > P b u         / O f }      $ : R i         #4L\l)DYu4BZfs(4G^{*BVj=Uf{ !6HWgy$6Obr6Rd .>Rfs+@Qm~-=jv"0DU^j 2BPk}2L[p*<HXh~):Mhx':Oe} ' 5 K ` y         !!.!-V-i------ ..5.N.n...../$/7/V/r///// 0-0G0c0t00000141L1o1|111112'2F2f222222333H3e3u333333334'4D4\4s4444444 5$595M5c5{555555 6$616>6K6`6x66666667 787T7p777777898K8l88888899I9d9u999999::2:N:e:x:::::::; ;?;W;k;;;;;;;;;<<(<:<W<t<<<<<<= =-=:=O=r=======>#>C>N>e>>>>>>>?(?4?O?h??????? @@.@A@U@o@@@@@@@@@@ AA1AAAOA^AlAAAAAA BBABXBlBBBBBC+CKCiCuCCCCCCC)D?DSDkDDDDDDDDEE7EZEbEsEEEEEEEFF3FAFTF]FFFFFFGG7GLGfGGGGGGHH/HJHWHxHHHHHHHII,IAI`IoIxIIIIIII JJ+JBJ\JhJJJJJJJKK-KCKXKbKtKKKKKKKL$L;LULfLzLLLLLLLMM)MEMdMxMMMMMMN@NSNjNNNNNNNNO*OBO\O{OOOOPP*P;POPXPfPyPPPPPQQ0QHQ\QrQQQQQQR RARURpRRRRRRR SS.SYSfSySSSSSS2T[TzTTTTTTT U U2UIUYUkUUUUUUUUV/V:VRVbVzVVVVVVVW-WCWUWhWWWWWWWX-XLXbXxXXXXXYYnXnmn{nnnnnnoo(o>oKonooooooooop'pHpapuppppppp qq/qAqPqaqqqqqqqqqr&rDrZrqrrrrrrrrs"s;sYsdsossssssssss t+t@tVtctttttttttuu&u4uCuZuuuuuuvv(v5vJvdv{vvvvvww-wAwIw\wswwwwwwwwx%x5xGxWxixyxxxxxxxxxy4yCyUytyyyyyyyyzzz/zGzPz[zizyzzzzzzz {{0{C{M{W{b{l{{{{{{{{{{||/|:|N||||||||}2}P}b}u}}}}}}}}~~-~<~L~\~r~~~~~~~~'=Uf0Raoƀ/GYuˁ3AXexĂ܂!.CNdz̃3MUky߄3[Ѕ݅/F^mƆˆ҆ۆ !&+29?EKQX]hmt}ȇ·Շ݇  '/@GNUZ_kry͈Ո MB,&@BKE $B r BE#BF%B$.p:B26BTBKTSBzp/B}UB792BXv@B O13`6B O 15BD^B.`3BDpQB~ BvPBW36BHBCNBuu@ܢW@,lA b@ x2\f`VGAb g4-/'C ( (-WGEpF"ra EyeAb~1%(TH6PLgd { #g:A&bc;7PFB=8< <mk%9.D\q HxLvkY/ZM4f]O2[R,cg YW5xg+j)0nug.I U,zD[Yz)2*d{@EnZnSsNm^~# Tr}a[yo,z w<dtQy+]3&i]ocsq}fH 5QJSpi2j;GRi sMj3DBx#HIJ8yd]C*u>hCoUjN%3ftItbYlQr?/XvRVe')+>$E8^P?A_iO.\Cc,6xZ;4- /m`+'-Kh#_"t!:ZuL'vb==\ob}}"L>jW ='g p>(XcAKuc8Xh!XMS5{fw)70W11UPh$[7!&cM9DBfpmte&kmZ.8qF_R96oM{$:o# _G.69Y:u`a7@l^kU03;|C2<[ jRIzk7n! >qyDEL*{mQpMu,|)z=xE9O<J;#_L H^4 aU0,9vK@N!B ]1} d{^N&R"U nAP% B+T?WV Q]5!/|@6MK'3!~$ FUl?*j`OWJ.dOye5{1~eiV=:FlDF5PJ@6>X VR-"K)kYS~3 q}P2&Z 2_yiKz&/8x4  AJ" BrHJGNwsonTT#* TCrh$ai\1v[O~X4[:b .v+t0 7url m_*zV0<Z)Q:W5@E%^%sh >S("(?f?|eN37`@XaGd||SLwKaY1sOG8-t `I$N\;vVp`qI;^*~l+F</$6(%\q, ']CpTewlkIwHs9D4?nhB}r=wS|Q-0                                                                                                                                           +p /p$)+p  0p .p\ -pi!#+p0ii ui ]C@ +p  -p i! /p $ ui `/NXNyN O ON ONNsNNN N(N0N&8N(@N*HN,PNXN`N"hN$pNxNNNUNNNNNNNNNNN"NNNnNNNN Na(N 0N8N@NnHNjPNXNu`NRhN/pNxNN0N,NNNHN:NNN:NNNN}NN#NNNN.N N(N0N8N@NHNPNXN`N2hNpN'xNN@NNNNNNNNBNNNNrNNNNNNN N(N0N8N@NHNPN3XN`NhNBpN"xNN+NVNNNkNNNNNNqNN{N$NNpN8N5NN) N(N00N8N)@NHNPN/XN`NohNpN*xNNNON[N?NNzNtNNNUNNTNKNXNNNbNNnN N6(N0Nm8NM@NdHNtPNeXN`N hN4pN xN1NN NjNNNSNNNNlNkNN NNNVNNiN-NN7 N(N90N8N@NHNJPNXN`NhNpNxNNNNNNNNNNNNNNNNNNNNN N(N0N|8N@NHNPNXN`NhN(pNExNLNNRNNNNNNNNPNNNAN<N=NNGN1NHNB NC(NE0NF8NP@NQHNRPNXNK`NAhNhpNgxN]NVNYNeNfNhN_NcNdNnNoNpNsNiNNlNmNwNNzN{ N(N0N58Nv@N HNPNXN`N|hN}pNxNNNNNNNNNNNNNNNN N NNNN  N (N0Nf8N@NHNPNXN`NhNpNxNNNNNN"N,N$NN N!NN\N-N.N%NbN)N*N7Ne N9(N/0N38N5@N6HNPNXN`NhNpNxNNNNNNNNNNNNlNNxNNNNN;N~N N:(N0N8N@NzHNPNXN`NhNpNxNNNNNNNNNNNNSNTNUNNNONPNN[N]N^ N_(NU0NV8NW@NXHNiPNkXNn`NrhNwpN`xNdNeN{N}NNNtNuNwNyNNNNNNNNNNN N(N0N8N@NHNPNXN`N/hNpNxNNJNHNNNNNcNN N!NNNN~N+N"N#NDN|N. N/(N10N38Nd@N_HN'PNXN`NhNpNxN4N5NN;N9NNN@NBNCN&NN<N>NNFN NK Nz N ND N( Ni0 Nj8 Nl@ NmH N|P NX Nh` N}h N p Nx N  N  N  N N, N- N0 N N N  N N N N N N N!N!N!N!NL !N(!N0!Nu8!N(@!NH!NP!NX!N%`!N!h!Np!Nx!N!N!N!N!N!N!N!N!N!N*!N!N!N!N!N!N!N"N"N"N"N "N("N0"N.8"N@"NH"NP"NX"N`"Nh"Ncp"Nbx"N "Na"N"N"N"N"N"N"N"N"N"N"N"N"N"N"N#N#Nq#N#N #N(#N0#N8#N@#NqH#N`P#NX#N`#Nh#Np#Nx#N#N#N#N#N#Ng#N#N#N#N#N#N#N#N#N#N_#N$N$N$N$N $N^($N0$N8$N@$NH$NP$NX$N]`$Nh$Np$Nx$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$Nh%Ni%Nj%Nk%Nf %Ng(%N`0%Np8%No@%N4H%NP%NmX%Nu`%Nwh%Nxp%Npx%Nq%Ns%Nt%N}%N%N%N%Ny%Nz%N{%N|%N%N%N%N%Nf%N&N&N&N&N &N(&N0&N8&N@&NH&NP&NX&N`&Nh&Np&Nx&N&N&N&N&N&N&N&N&N&N2&N3&N-&N/&N0&N1&N7&N'N='N8'N4'N5 'N('N60'N<8'N=@'NH'NP'N9X'N:`'Nh'N;p'NCx'ND'NE'N'N>'N?'N@'NA'NK'NL'NM'N'NF'NG'NI'NJ'NR'NS(NT(N(NN(NO (NP((NQ0(N8(N[@(NH(N\P(NaX(NV`(NYh(NZp(N^x(Nd(Ne(N](N^(N`(Na(N(N(N(N(N6(Nl(N(N (N(N(N )N )N )N )N  )N()N0)N8)N@)NH)NP)NX)N`)Nh)N$p)Nx)N)N)No)N)N)N)N)N)N)N)N)N#)N$)N )Nc)NT)N"*N(*N*N)*N& *N'(*NZ0*NY8*N@*N\H*N[P*N+X*N`*Nh*Np*Nx*N*N*N*N*N*N*N*N*N*N*N*N*N*N*N*N*N+N+N+N+N +N(+N0+N8+N@+NH+NP+NYX+N`+NXh+Np+Nx+N+N+N+N+N+N +N+NZ+N>+N+N +N+N@+N+NX+NW+N,N,N,N,N ,NV(,N0,N8,N@,NH,NrP,NX,N`,Nh,Np,Nx,N,N,N,N,N,N,N,N,N,N,N,N,N,N,N,N,N-N-N-N-N -N(-N0-Nb8-N@-N{H-NP-NX-N `-Nh-Np-Nx-N-N-N-N-N-N-N!-N-N-N-N-N3-N-N-N-N9-N.N.NW.N.N .N(.N0.N8.N@.NH.NP.NX.N`.Nh.Np.Nx.N.N.N.N.N.N.N.N.N.N.N.N.N.N.Nz.N.N{/N/Nw/Nx/N /Ny(/N0/N8/N@/NH/NP/NX/N`/Nh/Np/Nx/N|/N}/N~/N/NU/NB/NC/NT/NS/NR/N/N/NW/NQ/NY/N/N0N\0N0N0N^ 0NP(0N[00N+80Nh@0NiH0NjP0NkX0N``0Nch0Nep0Ngx0No0Np0Nq0Nr0Nl0Nm0Nv0N0N0Ns0N\0N0N\0NU0N0NW0N1N1N1N[1N 1Nr(1N&01N81N@1NsH1NLP1NbX1N`1Nh1Nap1Nyx1N1N21N%1N1Na1N&1N1Ny1Nn1NF1NG1N1N1N71Nv1NI1N2N2NN2Np2N 2N(2N02NL82NM@2N?H2N^P2NgX2N`2Nh2Np2NNx2N2N2N2NO2N2N62NA2N2N82N2ND2N22N2N2N2N2N3N3N3N3N 3N'(3NQ03N83N@3NH3NGP3N5X3N`3N7h3Njp3Nbx3Nu3N43N3N:3N3NO3NN3N3N3NO3N3N3Nx3N3N3N;3N>4N4N>4N4N 4NH(4N04N84N@4NvH4NoP4N@X4NA`4NCh4Np4N x4N4Nh4NJ4N4N84N4N4N4N'4N4N4N4N:4N4NZ4N4N?5N5Nc5N,5NM 5Ng(5NM05N85N_@5N0H5NIP5NX5N`5N-h5NYp5N*x5N`5N+5N5N~5N5NM5N5N5N5N5N5N5Nx5Nj5N#5N5N,6N6N6N6N 6NX(6N06Nt86N@6N-H6N1P6NX6N`6Nh6Np6Nx6Nq6N6N;6NL6N6NK6N6NI6NJ6Nm6Nf6N6N6N6Nu6N6N!7N7N7N7N* 7N(7N407N87N0@7NH7NP7NX7N`7Nh7Np7Nx7N7N7N7N7Nv7N7N7N7N7N<7NW7N7N#7N~7N$7N7N8N8N%8N]8N_ 8N(8N208N=88NF@8NH8NHP8NBX8NC`8NGh8NDp8NEx8N@8N8N8NA8N=8N8N>8N?8N8N8N8N8N8N8NT8N8N9N9NP9N9N 9N(9N09N89N@9NH9NP9NX9N`9Nh9N#p9N$x9N 9N%9N"9N!9N&9N9N 9N9N 9N(9N9N)9N9N 9N 9N29N=:N:N:N:N :N(:N0:N8:N@:NDH:NP:N3X:NE`:NGh:NQp:NRx:NS:N:N:N:NE:N:N:N:N:N:N:N:N:N9:N:N:N;N;N;NQ;N ;N(;N0;N8;N@;NH;NP;NX;N`;Nh;Np;Nx;N;N;N;N;N;N;N;N;N;N;N;N;N;N;N;N;NN&>Nx>N)>NJ >Nz(>N0>NS8>N@>NJH>NP>N}X>N~`>Nh>N{p>N|x>N>N<>N>N>N~>N>N>N>N>N>N>N>Nf>N>N>N1>N?NH?N?N?N ?N;(?N:0?Nt8?N8@?NH?NP?N9X?N7`?Nh?Np?Nx?NS?NT?NU?NV?NQ?NR?N?N?N[?N8?NW?N7?Nb?N?N5?N?NY@N8@NZ@N@N] @NN(@N^0@N8@Nk@@NH@NXP@NX@N`@N6h@N\p@Nx@Nd@Ne@Nf@N_@N`@Na@Nc@Ni@Nk@N@Nl@Ng@N@N@Nh@Nu@NpANqANrAN]AN, ANm(ANn0ANo8ANw@AN HANsPANsXANr`ANvhANpAN?xAN@ANAN;AN<AN=AN>ANAANBANCANAN.AN0AN1AN4ANEAN3ANFBNBNDBNGBN6 BNH(BN20BN/8BN@BNKHBNLPBNXBNI`BNhBNKpBNxBNMBNOBNBNBNZBN(BNBNBN+BNBNIBNBNBNBNPBNBN*CNCNCNCN CN-(CN+0CN)8CN'@CN%HCN#PCN!XCN `CNhCNpCNxCNCNCNCNCNCN'CNCNCNCN CN CN CN CN CNCNCNDNDNDNDN DN(DN0DN8DN@DNHDNPDNXDN`DNhDNpDNxDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNHn"oH5 % % h% h% h% h% h% h% h% hp% h`% h P% h @% h 0% h % h % h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h % h!% h"% h#% h$% h%% h&% h'p% h(`% h)P% h*@% h+0% h, % h-% h.% h/%z h0%r h1%j h2%b h3%Z h4%R h5%J h6%B h7p%: h8`%2 h9P%* h:@%" h;0% h< % h=%  h>% h?% h@% hA% hB% hC% hD% hE% hF% hGp% hH`% hIP% hJ@% hK0% hL % hM% hN% hO%z hP%r hQ%j hR%b hS%Z hT%R hU%J hV%B hWp%: hX`%2 hYP%* hZ@%" h[0% h\ % h]%  h^% h_% h`% ha% hb% hc% hd% he% hf% hgp% hh`% hiP% hj@% hk0% hl % hm% hn% ho%z hp%r hq%j hr%b hs%Z ht%R hu%J hv%B hwp%: hx`%2 hyP%* hz@%" h{0% h| % h}%  h~% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h%  h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h%  h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h%  h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h%  h% h% h% h% h% h% h% h% h% hp% h`% h P% h @% h 0% h  % h % h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h%  h% h% h % h!% h"% h#% h$% h%% h&% h'p% h(`% h)P% h*@% h+0% h, % h-% h.% h/%z h0%r h1%j h2%b h3%Z h4%R h5%J h6%B h7p%: h8`%2 h9P%* h:@%" h;0% h< % h=% h>% h?% h@% hA% hB% hC% hD% hE% hF% hGp% hH`% hIP% hJ@% hK0% hL % hM% hN% hO%z hP%r hQ%j hR%b hS%Z hT%R hU%J hV%B hWp%: hX`%2 hYP%* hZ@%" h[0% h\ % h]% h^% h_% h`% ha% hb% hc% hd% he% hf% hgp% hh`% hiP% hj@% hk0% hl % hm% hn% ho%z hp%r hq%j hr%b hs%Z ht%R hu%J hv%B hwp%: hx`%2 hyP%* hz@%" h{0% h| % h}% h~% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% h P% h @% h 0% h  % h % h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h % h!% h"% h#% h$% h%% h&% h'p% h(`% h)P% h*@% h+0% h, % h-% h.% h/%z h0%r h1%j h2%b h3%Z h4%R h5%J h6%B h7p%: h8`%2 h9P%* h:@%" h;0% h< % h=% h>% h?% h@% hA% hB% hC% hD% hE% hF% hGp% hH`% hIP% hJ@% hK0% hL % hM% hN% hO%z hP%r hQ%j hR%b hS%Z hT%R hU%J hV%B hWp%: hX`%2 hYP%* hZ@%" h[0% h\ % h]% h^% h_% h`% ha% hb% hc% hd% he% hf% hgp% hh`% hiP% hj@% hk0% hl % hm% hn% ho%z hp%r hq%j hr%b hs%Z ht%R hu%J hv%B hwp%: hx`%2 hyP%* hz@%" h{0% h| % h}% h~% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% h P% h @% h 0% h  % h % h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h % h!% h"% h#% h$% h%% h&% h'p% h(`% h)P% h*@% h+0% h, % h-% h.% h/%z h0%r h1%j h2%b h3%Z h4%R h5%J h6%B h7p%: h8`%2 h9P%* h:@%" h;0% h< % h=% h>% h?% h@% hA% hB% hC% hD% hE% hF% hGp% hH`% hIP% hJ@% hK0% hL % hM% hN% hO%z hP%r hQ%j hR%b hS%Z hT%R hU%J hV%B hWp%: hX`%2 hYP%* hZ@%" h[0% h\ % h]% h^% h_% h`% ha% hb% hc% hd% he% hf% hgp% hh`% hiP% hj@% hk0% hl % hm% hn% ho%z hp%r hq%j hr%b hs%Z ht%R hu%J hv%B hwp%: hx`%2 hyP%* hz@%" h{0% h| % h}% h~% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h%z h%r h%j h%b h%Z h%R h%J h%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% hп% h% h鰿% h頿% h鐿% h逿% hp% h`% h P% h @% h 0% h  % h % h% h%z h%r hо%j h%b h鰾%Z h頾%R h鐾%J h逾%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h % h!н% h"% h#鰽% h$頽% h%鐽% h&逽% h'p% h(`% h)P% h*@% h+0% h, % h-% h.% h/%z h0%r h1м%j h2%b h3鰼%Z h4頼%R h5鐼%J h6逼%B h7p%: h8`%2 h9P%* h:@%" h;0% h< % h=% h>% h?% h@% hAл% hB% hC鰻% hD頻% hE鐻% hF逻% hGp% hH`% hIP% hJ@% hK0% hL % hM% hN% hO%z hP%r hQк%j hR%b hS鰺%Z hT頺%R hU鐺%J hV逺%B hWp%: hX`%2 hYP%* hZ@%" h[0% h\ % h]% h^% h_% h`% haй% hb% hc鰹% hd頹% he鐹% hf逹% hgp% hh`% hiP% hj@% hk0% hl % hm% hn% ho%z hp%r hqи%j hr%b hs鰸%Z ht頸%R hu鐸%J hv逸%B hwp%: hx`%2 hyP%* hz@%" h{0% h| % h}% h~% h% h% hз% h% h鰷% h頷% h鐷% h逷% hp% h`% hP% h@% h0% h % h% h% h%z h%r hж%j h%b h鰶%Z h頶%R h鐶%J h逶%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% hе% h% h鰵% h頵% h鐵% h逵% hp% h`% hP% h@% h0% h % h% h% h%z h%r hд%j h%b h鰴%Z h頴%R h鐴%J h逴%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% hг% h% h鰳% h頳% h鐳% h逳% hp% h`% hP% h@% h0% h % h% h% h%z h%r hв%j h%b h鰲%Z h頲%R h鐲%J h進%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% hб% h% h鰱% h頱% h鐱% h週% hp% h`% hP% h@% h0% h % h% h% h%z h%r hа%j h%b h鰰%Z h頰%R h鐰%J h逰%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% hЯ% h% h鰯% h頯% h鐯% h逯% hp% h`% h P% h @% h 0% h  % h % h% h%z h%r hЮ%j h%b h鰮%Z h頮%R h鐮%J h逮%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h % h!Э% h"% h#鰭% h$頭% h%鐭% h&逭% h'p% h(`% h)P% h*@% h+0% h, % h-% h.% h/%z h0%r h1Ь%j h2%b h3鰬%Z h4頬%R h5鐬%J h6逬%B h7p%: h8`%2 h9P%* h:@%" h;0% h< % h=% h>% h?% h@% hAЫ% hB% hC鰫% hD頫% hE鐫% hF逫% hGp% hH`% hIP% hJ@% hK0% hL % hM% hN% hO%z hP%r hQЪ%j hR%b hS鰪%Z hT頪%R hU鐪%J hV逪%B hWp%: hX`%2 hYP%* hZ@%" h[0% h\ % h]% h^% h_% h`% haЩ% hb% hc鰩% hd頩% he鐩% hf逩% hgp% hh`% hiP% hj@% hk0% hl % hm% hn% ho%z hp%r hqШ%j hr%b hs鰨%Z ht頨%R hu鐨%J hv逨%B hwp%: hx`%2 hyP%* hz@%" h{0% h| % h}% h~% h% h% hЧ% h% h鰧% h頧% h鐧% h逧% hp% h`% hP% h@% h0% h % h% h% h%z h%r hЦ%j h%b h鰦%Z h頦%R h鐦%J h逦%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% hХ% h% h鰥% h頥% h鐥% h逥% hp% h`% hP% h@% h0% h % h% h% h%z h%r hФ%j h%b h鰤%Z h頤%R h鐤%J h逤%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% hУ% h% h鰣% h頣% h鐣% h連% hp% h`% hP% h@% h0% h % h% h% h%z h%r hТ%j h%b h鰢%Z h頢%R h鐢%J h逢%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% hС% h% h鰡% h頡% h鐡% h逡% hp% h`% hP% h@% h0% h % h% h% h%z h%r hР%j h%b h鰠%Z h頠%R h鐠%J h造%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h% hП% h% h鰟% h頟% h鐟% h速% hp% h`% h P% h @% h 0% h  % h % h% h%z h%r hО%j h%b h鰞%Z h頞%R h鐞%J h逞%B hp%: h`%2 hP%* h@%" h0% h % h% h% h% h % h!Н% h"% h#鰝% h$頝% h%鐝% h&逝% h'p% h(`% h)P% h*@% h+0% h, % h-% h.% h/%z h0%r h1М%j h2%b h3鰜%Z h4頜%R h5鐜%J h6逜%B h7p%: h8`%2 h9P%* h:@%" h;0% h< % h=% h>% h?% h@% hAЛ% hB% hC鰛% hD頛% hE鐛% hF逛% hGp% hH`% hIP% hJ@% hK0% hL % hM% hN% hO%z hP%r hQК%j hR%b hS鰚%Z hT頚%R hU鐚%J hV通%B hWp%: hX`%2 hYP%* hZ@%" h[0% h\ % h]% h^% h_% h`% haЙ% hb% hc鰙% hd頙% he鐙% hf這% hgp% hh`% hiP% hj@% hk0% hl % hm% hn% ho%z hp%r hqИ%j hr%b hs鰘%Z ht領%R hu鐘%J hv逘%B hwp%: hx`%2 hyP%* hz@%" h{0% h| % h}% h~% h% h% hЗ% h% h鰗% h頗% h鐗% h逗% hp% h`% hP% h@% h0% h % h% h% h%z h%r hЖ%j h%b h鰖%Z h頖%R h鐖%J h逖%B hp%: h`%2 hP%* h@%" h0% h % h% hUHAWAVAUAATSHHHdH%HE1HV ߷HV 螽 HeV H1@vjWJH H==V 1E1侐KaH="V 赚H=.V :WJ_L<WJ1F~H=U D[H=U werH8SH=U W{VWJHt81tqmIHtZH;IHnU HHuLLuHL3Euo FNL½wWJxuqH{E1AA|ArH{DEtAuHHDLWA~LsWJLWJLA>-tqWJLɝADž7WJL豝ADž8A AW@JAFNL謼AFh-xA~hmA~bWJL+tMWJLAtA>-AFvuGA~KLK迉%8J78JA~t-WA~vLA~<8JA8JE1VH1I^HHPTIpJHJHoBHH HtHffff. NH= NtHt Nfff.@ NH NHHH?HHtHt Nff.@=M ugUHM HATA NS NH NHHH9s%f.HH]M AHRM H9r0[A\6M ]@ff.@;ff.UHAWAVMAUIATISHMt|HI$HtlMtgMtbDxPAL輐A9HSXHCdCd;C`|hI$HCXIH[A\A]A^A_]Ð{J$Jw11Ҿg:t1H[A\A]A^A_]HcChIH[A\A]A^A_]DJ$J11Ҿ:H1[A\A]A^A_]ۏJ$J׏11Ҿi:ԏ1[ff.fUHAVAUIATISjMMHHDsPAtXLHA9tKH{HtB111oIHt]LHlLl[A\A]A^]@J1ۿ$J1Ҿ1:[A\A]A^]ÎJ1ۿ$J轎11Ҿg:躎[A\A]A^]ӎ~J$Jz1Ҿ1:wxfUHAWAVIAUIATISHHdH%HE1HMMMDxPHAtLٍA9tL<΍JEE1$JǍ1Ҿ1:čHMdH3 %DHH[A\A]A^A_]sJ?E1$Jl1Ҿg1:iL蘍Aǃt(BBLE1諍HIAh@1L融HI裍1I褍IH8L蠍==$=yHuLHEuLmLcHEHELHEŌM41LHMHUHuH%tQH}H1轌Ht 8j pJ$J1Ҿ1:I>E1Ռ,=H{(̌HI>HťfE1HuLHE謌tH}H{0t(訌H}I蜌LH行H{0Hs8HS@蘌HwL訋HgHE背IH'H;E111HL}tp脌HHtc肌1ɺHH而H舌HE芌HuH}I芌H}艌L职H艌L葌H}蘌^pJ$JZ1Ҿ1:WR111臋Hf1XHWH}tLQH}HUyH{H}LϋH}E΋LƋH΋HuL"H%LhL)HLފv聉pJ$J}1Ҿ1:zuDUHSH"Ht-@dHxXHʋHCXH[]fD J$J11Ҿg:H1[]ff.UHATSH衈HI覈MtQHtLw1Hs [A\]AL$`1҅~AD$duH$HID$X҃@[J$JW11g:T[A\]UHAUIATISHFJHH=H dH%HE1觊M>HL蚊<JyJH=AH HHDH1hHHwH=H JH1ALهH=G J11Bf.~H=G J1L̇H=G HLp9|H=G J1蹉HEdH3%ubH[A\A]]@H=YG J1腉H=AG J1m'H=!G cJ1MUHAVMAUIATISHDHtHt[LLLA\A]A^]$@;Je$J7[1A\gA]:A^1],ff.UHAWAVAUMATISHHLuL}H}HMLEdH%HE1衅HHM?MHM(MLwECP9C`SdIEII~V9CdL#}HEHH;HIHmHLHEL#HEMLILHEHuHHtQH}HEHUt<藄@Jo$J蓄11Ҿ:萄1fHtH}H菇uH{Ht芇IEHteHuH}脇xPH{ Ht yIHt1H{(Ht cIHtH{HHtD]Hu<IEHTIEI>TII?EI1HudH34%yHH[A\A]A^A_]f.k@J*$Jg11Ҿg:d1H{HކIHH}نLHنLنIE$L蘅HCXH=11轆,軂@J/$J跂11Ҿ:贂1DLE1}H腆HE AH}軂D9(H}DHHEH=uH}Hu>xH}mH}1蚂HHHHJ 迁@J[$J軁1Ҿ1:踁E1胁@Ji$J11Ҿ:|1P@JW$JL1Ҿ1:I@JQ[苃ff.UHAWIAVIAUATISHHMDhPHAL覀A9LL L#ML LI貃IMtRLL迁tCfXJ$JbJ1:\H1[A\A]A^A_]MtLLXuH{HH[A\A]A^A_]}DXJ$J1Ҿ1:f.XJ$J1Ҿg1:Sff.@UHATSHQHtLLLHLPL@HEHMLxNLPLHL@uJHH=q/ 1qH=c/ s;H=R/ 1E1E1HJxqH=9/ s1NLPLHJL@H=/ 18qH=. sJں`JeJHHPtHPHIHx1HME1H=. mJpHMHsL?sH=. HEE1E1sJ[pDE\H=Z. tHpJHP0E11f.UfHAWIAVIAUAATSHHXH}dH%HE1)E)E)En11HtHHEcp1H tHHHtHtHEH tH}H<?H}(H]IHsIHwHHlnNH=%- AI$8RRIT$1X J5oAyArLAILHHEwsIrLL9uH=, Lr J1nfDfJJHEI$HEID$HEID$HEID$HEID$ HEID$('foMA $foUAT$fo]A\$ ID$0ILpfA)E)E)EAHH}LDL9A.11pIH JDpMcL%`IwLHIpcfD1LNpIHSpHEJMH=( L J1j&f.H}11|oIHu:H=( J1AjcfDH=q( LJjH}AoADlMc JLI_IwLIH'oLLᄍ J'oHuLLohAH]H=' J1AjHUH=' : J1AiHUpJ1AiH='  J1iIG! JH=~' HP 1iL纓JkA;HU@J1E{i#1iUHAUIATISHHmHHtHH[A\A]]fH=' LL1J'iHH[A\A]]fUfHAWAVAUATSHhHEH]hHHH}(HHEHHHE HHHE@LHHEHLHHEpHHHExHdH%HE1)p)E)EHt8u0 J}sH(IH2HH_mLgmHE1ZmDHHuH0TADž ۃM@H}H}1TH HMHHE1 @E1H= 1E1E1a JOfH= a JE1E1N@H= L1E1| JNHUH= J1NH=w J1E1NH=\ J1NlHE1S7H=/ a J1[N?HUH= JE1>N"fUfsLHAWE1AVE1AUAATE1SHdH%HE1H )pHDžH@9 ))))DžDžHDžHDžfeHDžgƅoDžDžHDžHDžHDžHDžHDžDžHHDžHDžHDžpDžDžDžxDž|DžhDžXDžpHDžHDžHDžHDž(HDžxHDžHDžHDž HDžHDžHDžHDžHDžHDžHDžHDž8HDžHDžHDžHDžHHDžPHDž0DžH Fe G>  ~m H렃-W %( J!#J UDH= HJ1JH= HDž(Dž@HDžp1E1E1HDž8HDž HDž`LDžXLR1R1RHpAt8HH` J@HHKH:[HH`X J@HHHH+_H8HE1H8H@Hx:A9H8DH@Hx.:HH8RHC8$Hs17D#H[H@;-uHH##w8D8HHQDAuH=v AU1AȾ(J;H=\ 1E1E1HDžpHHA< JHtH(HtsH HDtOEHD(H@H 1HctHDž@H= J:H= 1E1E1HDžpHDž8L(LB?fa JHxH)0)@)P8/HH0HHHLHx??HHDHHH8H0Hxk>HHHHH= AH=) HھJ1R8H= tDžhLCHHDžHHHDžHDžHDž J19H1?H%>AUDJH= 15NHH= J15/HH J1H=v H5H>EH8~:ht4EH81AŃ:EHHt11HTHd HxE;HxD t'HHXH PHp=AŃ_H HeJ;t JHp;uHpHEEEHHH`_J$H]DHDžH=5 11E11AH:H5 H:H1H= H:=H HYH H=, J1X3 vfD8u4J2 H׵ f..Q Hŵ 6o Hm <7:"H MaH ]D#I: D_)H /H5ڱ 胕fD>YH : H H kHԳ gSH O 9+H 'H̳  H H, H, H< H sHd o[Hd WCH\ ?苌2 (  H H  ¯ @ fH Ӌ p軋m XJ I;H| 7#HT  H S1 H4 H| HT ~ {H wcHԮ _KH G蓊0 0H$ cu0 Ḫ HL0 H| HT H$ sHT o[H Wn Af+Ht 'H, H H\ H Ḫ m H zHî vfDcH _KHD G6 1fHt c. =. HJL1hJH= JAJhJA hJH |H {H wcHd _KH G3H /Ht H4 HT 3y- =m- HJL1hJH= JAJhJAV hJH OfkHܬ gޫ Qf 9 )H H  ; +5, H HD j {H< wcH\ _=, 'HJLH=M hJAJABJhJP1bH fUHAWAVIAUATSHHHH4sHHHL%a IM}LLLH=) HCJvIHt5H= BLZLLLAbEiH=Ѩ L%¨ 1 H= Mt\8JL11A8JHI'LI MLLGLAEH=D L=E MthD% `J1LA`JDMHHE+LUILMLLLH=Ч #H= H_J1IHHLH=y HJ HtFH ަ JH!1IHLHjLAEH L% MtX0JHL11A0JHI>&LIMHLojLAtE{L% McH= J*L11AJHI%LI'M.HLjLAEL=8 H=) MthD% J1LAJDMHHE)LUILM6LHj#LH= ?H= Ht9J11E&IHiHHjLA#EJH=[ H\ HtFH (JH3/IHHHjLAEH H= HtFH |JH.IHHHjLAEH L% Mt_PJHVL11APJHI#LISMZHLkLA4E;HT L%- Mt_JHL11AJHI#LIMHL$kLAEH L% MtXJHL11AJHI(#LI}MHL9kLA^Ee5S Hl5% HmD 2 E s%  t$ =% H ΢ 5Ԣ H kD E= 5  v d R t HHeH[A\A]A^A_]L% MH= $ HMH= H=| 8=$ @H1&mxL%Q c$ Mu~HJ؀L1hJH= JAJhJAhJH LfDLH1lf=# HJ؀L1hJH=' JA JhJAhJ7H fD=# HJ؀L1hJH=Ϥ hJA JhJAhJH fDHJ؀L1hJH= pJA JhJAhJH HJ؀L1hJH=4 JAJhJAhJLH #=" HJ؀L1hJH= JAJhJA4jH @=I" HJ؀L1hJH= JAJhJAhJH ~fDH-fD; YfD=! ;HJ؀L1hJH= JAJhJA=hJH fDHgfDHkfDL^fL>fH3H؀LJ1hJH=B XJA JhJA8hJR H "MH=u 8DUHAWAVAUATISHHdH%HE1H= HDžxH= Ht>JIHHHWLAŅ= GH0 D- H  E H= RH=z  H=Ş Ht> J\IHHHLAŅB<  H5 H= MHMH=ܝ = Q1jIH6HHcLAŅEP x H Ht =  ,H= .L-ĝ Mk H D5 KL= H HDdHX DAK1MHLHhLhILnL=_ MLHNfD  H=œ  H= = ~EHAJAJhJLh KhJhJH=О 1H DE1H]dH3%DHe[A\A]A^A_]H= H= H=Ĝ  = HJL1hJH=; xJA JhJAhJKH dfH=ɛ HtWH=T V = ~@HJL1hJH=ѝ `KA JhJA hKH H= t= t =# %H=5 tI=  ~@HJL1hJH=^ KA JhJA&hKnH Ԛ t = sH=Ú tI= ~@HJL1hJH= pKA JhJA*hKH H=` tI=O ~@HJL1hJH= KA JhJA,hKH H= tI= ~@HJL1hJH=N KA JhJA.hK^H = tI= ~@HJL1hJH= KA JhJA0hK H D= EH= tI=G ~@HJL1hJH= 8KA JhJA4hKH = xD5՘ Et = _D- Eg= H= b@H=x P= CHJL1hJH= KA JhJA=hKH ;=D HAJA JhJLhJhJH=v J1H fH=8 EH=y  |= HJL1hJH= KA JhJA2hKH fDH=8 Z=; ~YJH=ԗ JH= HEHLAJhJAJJhJP1H4 H H= rHH=/ 1E1hJAJAJhJL0JhJ+H -fH=0 t =o OH=Q kH=  H= t =< H=~ h=! = >H= 0= #HJL1hJH=G KA JhJAh0KWH fDH= HX= E1= { H= HHxH1AE1L1H}H5Ȗ H}HH HtH= HxHu4 H HtH= HxHuq HxHjL"HjAŅ?H=  = AiAkA~uu A~r JL f.H-H5;~ HtHH5~ HtH| A?/IG^JIELLH0JHDHJP1H5} HH=} %Y^IHHJ1HlHAJAJhJLKhJ5A} H="~ 1SHH 7HJL1hJH=} ` KA JhJAhJH E1H=| =H HJL1hJH=} KA JhJAhJ覿H DL8@HAJAk JhJLJhJhJH=} 1E1IHH -fA~rtIJLL{ArrA~rgA~\: A~u H=y HtNVBAƅH= Ht(ENnBAƅ[ H= HtENHBAƅ H5z  HG ~= H=z t = :H=zz =e H=Wz (=: Hz -HT=- H=pz HtCH Tw H5x JIHgHHLAaEeL5z H="z MH= H= z Hy = =L5y Hy MtgH=x 8K11LA8KHHQLIL蟰MHL+LA耽EH=Xy HGJ1IHtHH Lh3HJL1hJH=z KA JhJAhK$H H=xx tM=o HJL1hJH=y @KA JhJAhKͻH H=x = HJL1hJH=by hKA JhJA hKrH xfL5x MBD5w E`H=v HtkH t H5&v `K,IHHǾBH5t LAƅ|LAHTLHYDv E Du E  t H!   9 ¾ HH=t Ht  t H =  CHDu EPH=t Ht  H; J(躻IHHvHnLHsHHHxmHpqHyIHHBH=7t HC 16J身HHHL?L1Ҿ@H=t HuH=s gH5r 1Ls HAPKHHDž^_HHHAEHH1ҾXJ(IHHH聹LAƅSH=Wd Ht>J޲IHbHHGLAƅ ĬL%=c M?HHA$DB O:LhIH AEH@1LH2IHl Hu =S 踸IH7 JI}詸IH LyLHM9 A$t <, IHeIHy HHZb LLRLLWIH# HHPA$HHDB AD$IJI}贷w I,LHH$HPHطIHILHHŷL#Lھ LL_L%` MH1%IHTIH1HLLLHHHP8LL5L-IHHHAƅuLWHH=(_ 2HAlH=x` 1L-` M:H=e` XHJLH=a hJA JAUKhJAT H HJL1hJH=a KA JhJAhJƣH=^ H H>H=^ HDž= SL/LH軨= KAJATA JhJLJhJhJH諱 =o +Hݣ¾"HytD HeI=& AJAVAJhJLKhJ5^ 4H=^ H K1ҔIHdHHLĴLIDH= AJAWAJhJHLKhJAV=Q LhL`RJLH=_ hJAJAKhJhJ覡H RHJL1hJH=Q_ PKA JhJAhJaH =  KH=[ JH=_ HERJLAJAa KPHAPH0P1HH H[ H=[ iJD5[ Hpn1DAiJHpMHHhLhILXH=Y[ M(HLHLHLղLUH=@\ 8H="\ H='\ 8mHpELhL`HXEH=] K1迟o= }AJAPJA?hJLKhJhJE1= 3HDžHDžpE1iLܱLᅠBE1茮HPH=\ AHJ1hJAJLhJKhJH QH=\ AJ1hJAJLhJK5Y 褞H H胫= ASH=M\ J1hJA JALhJKhJLH E1= BLLE1UL蝠LLL趰H赝QH=[ AJ1hJAJLhJJhJL赝H LnE1E1Z= zAJASAQJhJLKhJAT= "JSL`KhJAJALhJAT=~ AL轚=a E1E1E1PH=Z AHJ1hJAJLhJ`KhJ诜H = FAQH=XZ J1hJAJALhJpK5CW ^H = MAPAJA}JhJLKhJH=Y 1E1 H E1=W AJARA\JhJLKhJAUARJLH={Y hJAJAK5V 5qV 茛H 0= {AcAQJAJhJLPKhJAT-VJLH=X hJAJA0KhJhJH WH=X AJ1hJAJLhJKhJϚH E1UHAWAVIAUATSHH>dH%HE1HW zDcAuafD9}QHcÍSLIƀ8-uHwJH!KDSHW D9|Hi 8p賬HS HL%V MA<$L;%W c =  1LdHV H1L- A}cZA}mOA}pDA}9LH薢HuI= ~@HJ0LH=W hJAJApKAT5} H @AhLAJMHtMHuAII$HuA(LE1AJhLHDžDžfDML裟ML莟C0- ш?7S BӃF$ŀ|LJHuKDSH@ sJ HAAEELK|2w- S/H eJ= AE11H=QS ܊H=R ЊH=9R ĊH=R 踊H=AS 謊H=MQ 蠊H=YQ 蔊At H=S H=S Ht}葧H=S 1I萧H=S 蔩HH=S 萩H訣H=S 茩Mt.I}J褘I}J葘LH=P ]HH=>S iTDHUdH3%0He[A\A]A^A_]L%S Mt A<$AE1H=S 11Ҿ B=pHEpH1HHR H`LJADžz/DP DH=uP H11KHH H=:R 1ۣH=,R BjADžH=P P  c=l 5 H=fO VH=Q  E1=@ A|HJ0L1hJH=R !KAJhJAhJ蘔H 7AE#HJL1hJH=$R JAJhJABAP18H LИLI\I9H`HHH=P `N#H*H=; H9ufL%! HP LIWM4M9t7fDLLIHtL`NLUHM9u2E1HL;M LE1A*H=P HAJABJhJLJhJP1H=P H L%1 HO LHcM4M9tRHLLfHLHHtL`NLMHI9uH# H=O J1E1A 1D LAE11[6fD@=) `HAJA]JhJ0LJhJhJH=VO 艑H 8HHH H,IIHLHHH8C pNu MC l<v-{NrMtA}LD苅LHH@LL(XHJ0L1hJH=TN KAJATAg5 fH D1L莣@= AHAJAhJhJ5 M H=M J0L1 KH =9 pHH=M 1E1hJAJAJhJ0L KA5J 荏H ,@nt pMLIHI9dHH@Lf.H 1JQLpLҜHK { -LXHPMHDžsLHH@LL8GHJK1hJH=IHtoH=gE HכLopBHI菛ADž= AAAQAJhJhJ5#E HAE1H=B H={B _=F APH=E AJ1hJAJ0LhJ"KhJ衇H @ 1LH5A H H=B H=BD t = A t =  H=A l= "HA HHA HA HtH=C ==I H=C H$ADžtD5 E HE1E1HC = H $Ÿ~LH=dC Af H=DC יuJA{H=&C HH辙HC JH)EtTAAvJ=c ~AHJH=C A JHDHAy /KP1RLQJŅH z JH·H=B L=(B ;JLHEd\H=[B L%A JLHy1H=0B M= IH>H=R@ L=C@ HtMtL1NJLLyyH5@ JL-NH=A L%/A 肘NJLH2y|D3@ H=tA E^AD95 HE1A1ҾHE1.HIAH=A 1Ҿ1Ҿ11Nj? ==d=C = t>=3 =? 貂1HؕH HH褗 H褗HHH  AA:H¾PHpiH=  AD; HAwHHHu=\ E1뽐JHL= > HHH=R> IHL%@> HDžMt mPH=? A J1hJAJ0LhJ8%KhJ跁H < = AWH=_? J1hJA JA 0LhJ%KhJ^H r= AAUH=? J1hJAJA0LhJ%KhJH PH=> A J1hJAJ0LhJ$Khh$KƀH HC; HtJ= PH=q> A J1hJAJ0LhJ$Khh$KpH H=: = PH=> A J1hJAJ0LhJ%Khh$KH: H HJ0L1hJH== #KA JhJAhJH `HD: H8: LL[H5: JLtHAA H=; HDžH`HHH誓H< %HHH H5; NJsK H; AH}HH=< P K1~QH=< A J1hJAJ0LhJ@$Khh$K~H =H=: HDž8HDž@HDžH L=: M H=J9 'KL11A'KHI蘷LIqM?LHH@LHH8tAąt^H8V M H57: H8QJ} E1H8w~H@k~HH_~LW~Hh: PH=C; A J1hJAJ0LhJ$Khh$KB}H HL濘K1 HL`KE1 |E1=O ASH=: J1hJAJAJ LhJ /KAW|H uPH=i: AJ1hJA JL5  K3r|H 1ø H=\9 HDž8Dž0bIH_AE1DžDI߉Ëu6 ~ A9$H9 HDž@HDžHvHML0jH8HH@jHHSFH ÅuPDE+1L11LH85 HDž8PT]AHHtH@8tJH€HǺ J*}H=7 HH7HHHHzH c0H=7 :JLH8IH}z0LVDž=H8JH=@7 = H@ J8|HHykLHE1E|LAmH;~D=_4 HAEa脂E1ANH=5 HDžHTH=5 ]L%5 MTHDžH=5 )K11IHHH=|5 t=H=z5 t3HwLIxLHwt =[ PHHHHHH腍AąLHM' L=4 M= j踅HP|HHLlH =t  LH=#AHuzHxHyHHyH4 VH=5 AJ1hJAkJ0LhJ@0K5X3 wH s= H=4 E1&= A~>AWH=N5 J1hJAJA; LhJ.KhJMwH HB蘆H=4 AJJLARhJHp`/KH=4 PAM 1AWvH =B ATAJA JhJpL(&KhJhJH=q4 1E1vH H|3 H=ײ AQA-AJJhJpL/KhJhJH=4 1E14vH=3 H H8H0tXL0Mx=V )L%!2 ML踃軃8x= E1yJPpLp.KhJAJA!hJ5I1 7WH=<3 AJ1hJA JȀLhJ#K@BuH PH=3 A J1hJAJpLhJ(.K50 tH )LE1H8d}L\}E1EAu=& AQH=2 J1hJA JA pLhJP'KhJtH iE1=Ӱ xARAJA JhJpL'KhJhJH=2 13tH H1 .SH=1 AJ1hJAE JLhJ.KAWsH LAE1H5(0 H@kJsH50 HHJE1rA= APH=C1 J1hJAJA pLhJ(KhJBsH cL%/ MGH=a/ H=. x)K躜L11Ax)KHIbLIHfMtH=/ HDžHZ= H/ AJASA JhJpL&KhJ5. =ʮ bSH=,0 A J1hJA JpLhJx&KhJ+rH E1=x AJQpLJhJA 0)KhJhJ=; AJVJpLhJA (KhJhJdRH=m/ A J1hJA JpLhJ)KhJlqH nHDžE1+E1#Hq H=/ *K1.q= E18|PJ`L*KhJAJA AWhJH=. 1pH HH=" WH=. A J1hJA JpLhJP(KhJpH L BHAAH8H=J- $JL@PH=- AJ1hJA J`LAWP*KhJoH WA JK资E1>=& JP`L*KhJAJA hJAW= L=+ MtLAL}?O}81E1= !PH=- AJ1hJA J0LhJ JAWoH AWhJhJATH=, J1AJA 0L JnH PH=, A J1hJA JpLhJ0+KhJnH H* JH!wIHLHƿBUAą= gLpH8HH)HqIH~HǺ`,KJ1mHH1H%H2H¾8JL1mHNk9HxkHH蹂HkH=A=uH蝂!JL1LmL%s) ML{{8=u ZShJhJPH=* AJ1hJA JpLhJ *KhJlL=( H MLHM(DHJACHρHH,H@HI迁 JL1@lH@Lq,ILJ1 l腁E11LHLro0`,KNJL1k1ҾLH#sH== LmH' HtYL8MPJH)tIHLHƿB]Aą= MLmAH0jH80BzzVH=( AJ1hJAY J@LhJ,Kh`,KjH )=, Q@LJH=( hJAJA[ \JHP1jH = WH=:( AJ1hJA0 J@LhJ,Kh`,KAjH JL1)jg=} uAPAJA* H=' hJJ@LJhJh`,KiH 4AQH=' J1hJAJA PLhJ,KSiH Z= LkJ=ڥ DE19ARH=/' J1hJAJA PLhJ+KS:iH ASAJA JhJPLx+KhJSH=& 1hH PH=& AJ1hJA$ J LhJ-KShH u= PH=m& AJ1hJA J LhJ-KSxhH =Ȥ JP LH-KhJAJA hJS*= WHvv8=h JP0L JhJAJA hJSRH=% A J1hJA JpLhJ-KhJgH# H HLWE1 fff.UHATAHSH }]$ +t uAuH~yD[A\]fDUHAWIAVAAUMATISH(UdH%HE1\AHdAHH|HEHAtcAA|H=}$ L!J1fH}1k|HMdH3 %HH([A\A]A^A_]fD11HuL@|H]HuH=$ L0ZKCf뛐HuL$|fuHMLL|@H=# HþZK1fbeUHAWAVIAUATSHhIHE1^fDDLcE1ɹ1I11uIHt{HHtMLHct>HLct,ALcD9HL[A\A]A^A_]fE1BLE1tHE{LtE11ԐUHAWAVIAULE1ATSHbD9~z@DL1bIGfDLbH=" "JIgH=p" LzH=a" JgL'b9LAbD9H[A\A]A^A_]UHAUATIuJSHlHtQI1"f.LbLH(nLa9|LTfH[A\A]]@H1[A\A]]UHAWAVAUATISHdH%HE1HEHDžhHDžpHDžxeHEIH3vHEIHHEDžTDžXDž\Dž`=HMt MDžLE1E1E1HDžE1HDžHDžHDžHDžHDžHDžHDž(HDžHDžHDžHDžHDžHDžHDž8HDžHDž0HDž HDžHDžH= ydHbH}bHtH,`H( `R"JHcS"JHcT"JLcHfLwH_H_Mt(I~_I^L]"JqcIHuH=nLbHaHaHaH%bHpYuHxMuH}4wH8vHvHpHcH bHhbH0ip"JHbH}q"JbH{cLHMdH3 %1He[A\A]A^A_]JAE1E1LߺLE1@HDžPJHHDžHDžHDžhHDž0HDž`DžHDžLDžDžDžHDž HDžHDž(HDž HDžHDž8HDžHDžxHDžHDž@HDžHDžHHDžDžpDž@HDžHDž0HDžXHDžHDžHDžHDžHDž8HDžHDž(HDžHDžHDžHDžHDžHDžDk+A U   F_ 9utHfDA6X 0!k31H:f.DD'AmH0tH0HuKHHp0HtHHx H0AHD%HHH (tAAiAEIH11HU@㿉%D%lHtH= ]K1[ABDDžTEAHHt11HUA"JAH8 Ȉ0HH1ɺ1A"JyHHAA AAˆkHHDžHDžHDžUH=F ]K1rZDžLE1HDžHDžE1g ~Eu(kHT&H&D:HX͐HH= J1YDžLE1HDžHDžE1HDžHDžHDžHDžHDžE1HDž8HDžHDž0HDž @ u]Af. g iH 2) DDwuCA`2WHFfD4u+Dž@,@ځ DD5DD-). AD; >  D/HXNfD=?H 1Hr\HH}H= A"JH1'W;f?uKVH f.89u<'H_Mf@H(fD:wH HuHlHHHEH`8E'H0fDH/IulHYHHjT0D=D=AP}WHfDJH>HHS]#A;2D=5==FrHZwHHHDBHfD/"H\fDڃDukA ]D%W(p&)fڀD w! uLDžHD=H@ځDDAH@)u;"#u\ˀd@ڃ'DP*GHDžP"J4@=%H@ځ$DDDDADA DDžLDžDžADA uDE1hA UDAEDA5DA%DDžpA DH8tkHxHHxHWP"H(H8H(.PHDžxH8zf.HxtyHXHxHOH8HxHHEH(H8sH8H(O[HDž8XHx@CH@DLE1E1E1-DžLHDžHDžHDžHDžHDžHDžHDžHDž8HDžHDž0HDž DHrMfDA5H8H x_H(DžH(cM…H Ht9t`~"J^DHQHHHG8HGMH H Hx~H HHyMQfDSH`H fHHHHHHgHOH7AH8f /_@ [1ҾHHHh HuH1dHHg HEH0 xhXH(DžOHHOHHifDkOHHIfDKOHH)fD+OH(H fD OH(HxH=r ZKH1LH=R PZKH1{LfD11AQ"JHąHb HHHJHDžLIE1HDžHDžHDžHDžHDžHDžTt  H8tHxHxH HxHIH(H8HxH(HHEHIhH11HUsHDžxHDž8H D% H= [KMHZH HFHPH IL1H0H8tH=< @]K1hJtXAu DžXDEҺDHEDžcHp+ HH ˆK H0H8H D L0'HHG II?HT AQ"J1ɺ1тHHuHDžIHDžHDžDžLE1HDžHDžHDžH= J1HH8H 8HhH HDž8zH=x \K1HHDžH0H8FHhH 2HFH= H\K1HHHDžQDEuTHHr蘏HH HDE~TA"JHhH8HHt4HhIH"JDPH0HhHHXH8]HXHH0H0HHHDžH@H\6 J"JHEOHH \H11A>#JHHuXHw3H0HAHDžAˆXA AA A"A AT AA πE1؉E1 D@HHoCD9v HDCH(DHHx~CA\#J11HI~HH LHM1L狵`A"JSHH\ Mt LE;.uD9+H[HuDHMHHH8y[IH MtLLm[ HAEHEHDžHDžH=_ X[K}GHEH=; [K1gD{H=# 0[KAGHDžZHDž8H81ɺ1AQ"J}HHHH1ɺ1A"JM}HH0H8HDžLHM1A"J`H8肁HHH4AHH%@@usHHuYHDž HHDž8HH= 0^KE1BDžL@H= ZKEH= ]K1B@H=n ""JE1H1BHDžDžLH=6 xZKH1_BsH= 2"JH1?BSDHHMHHH8XIH LXHpHC1HH@? @H@i?9H@?HpHH8QH8H=S 1E1E1F#JyAH=: CDžL9H= ZK=DaHDžxH= \K1%AH= l"J1 A!Hx1ɺ1A]K]zHH5H8HDžHxH8H8HDž&(RH=P [KnCBHHH= ZK>C|ƅHDžUH8HDžH8^0H8pHDž7IE1HDžHDžHDžDžLHDžHDžHDžHDžHDžHDžDžLDžLIE1dH=; "J1E1dH(Hc"JA>OHHH= E1E1\>HDžLHDžHHDžHDžHDžHDž-H=i E1=HDžTH8H8}H=7 _KE1E1_;DžL+D@AH UH1AH8RDžLE1E1DžLE1E1DžLE1E1@tH @HU1QLA1PH Q^AXHH8H0HHtHQHH[ SH@H> HH& .IH }DLL@I13QIHH@BE1E10ILBE1 IH= ^K<DžL{LH 1H8P4HvPtqHDžE1E1E1DžLE1AH H81҉?PH8AE1111O^KH= E1E1;DžLzH0HhE1H8Ot.DžLE1QH0H8E1OuDžLE1HHUAH8HOH= 1E1E1侍#J7DžLL0HhAفHHuH8]O۸"J"JH=j HDо#J17Hxt.H8,OHxHH qH5LH81NIH}LEHMHdHuNH= 0$J9H}AH}A_8H= DHNH= F$J9H}H=} V$J9H}H=c $J9H}xH}LL49fLB4HuHFNH= ھ$JA1>6EH= $J9뚅۸"J"JH= HDо#J1E15H E1 LdH= tFu1l$J8 H=n @_K8H=] 7s$J15^$J`8L0HhAE1H`HH8=MH0HhH8$M#JH= 1E14HxH= E1E1#J4DžLL8LuLHp1H2HMHAHHLIH=LAJLL8LE1H`AHAQHpE1LH PPLAZA[H8؀@AljL]LD1HpH ILH8H؉E1 @DxHHB1D9HDj1M|ME;.uE9,$t Md$MuDHHHHH8KIHHKHHtiMtdID$E1HH@08GfDH@D0HHHp7CHp~^AH@\0A9|HpKE1HA K HL Kt@AH=/ 1E1E1F#JE1R2H= 4DžLHxtLJHx11E1HJtE1HDxHtEVL01HLH`jjH8jwJH HnHDžHhtCHhU"J5IHt^AWH811jII)JZYHt9HDžH ڃE1JH8DžLE1E1HDžE1E1E1HDžDžLH= X^K10wE1E1HDžE1DžLHDžHDžHDžHDž0J HuE1HH I;IH8 1H=t:+IHHt-H&I HH&I HH&IH8H1E1H0E1IH IDžLX==H H8H0HH=9 1E1E1侴$J_/DžL+H= 1E1E1o#J7/DžLE1E1E1HDžHDž0DžLHDžHDžHDžHDž8HE1E1E1H= "J.HDžDžLHDžHDžHDžMH=3 E10HDžHDž.E1E1E1DžLHDžHDž0X[SE1E1E1H@E1E1E1H= "#J-HDž0DžLHDžHDžoE1E1E1DžLHDžLHXE1E1E1H=" #JP-DžLHDžHDžHDžHDžHDž0E1E1E1DžL`_KH H8H0\*JH(cH8HHDž(HDž0E9HHp \H*J1vcIHdA+J11HE1fIH\ HhE1HLH8#BLI*L)M H8)L8HTAEDDDD3fD9q9A97A99A9=9 9$uAtH=u h+J1'H8]'HEAH=N Y+JH1o'bf. e AD$AGu,JqFAHD@ AD!AfD%jAD$ A1HDž(E1HDž0HDž8 vfDAeDDžHQAEDDžD1Dž@!AD$H3DfDAHfAD$ADADHL1E1HDž(HDž0HDž8;H(?#H' AH fH\ HdH_fAD$ADSH0{HpHtSHWbHHfH8I#HHLHxH=IAtH= G+J1#xH=u zLY+J1#H811ҾXT=H== 2+JI1^#MUH= =+J4&H= L%=L .H= J1#OH8"H= *+JH!H= 1+J"H811q@UHAVAUI .JATISH_H./Ht [A\A]A^]þ$.JH/HuiHDPtI\$IHLH.HHtlIT$I}(.J1?AEAEt'I}/.J1H[A\A]A^]_)I}J1AEfDI|$~.Hu+@UHAWAVMAUATIH}SHHuHHHE L}MDEHѺLm(HEdH%HE1HEHEHEc!;MMt}LEHM1HUH-mKAƃu_H}f.JLEHMHHUHHE-LUH= w.J1LULU#(nKH= 1AE1Һ-JLHuH}-JK-H]dH3%DHe[A\A]A^A_]fDHcULELHHM-E#JL1A*E1nfH= L1.JAvC.JL1E1E12fDAUMLLHULMjE1DELUXLUZP.JaUHAWEAVAUATISHHXHELmH}MLu8HEHE(DEHEHE0HEdH%HE1HE ft~11Ҿ Hu11ҾHxuT LHyH= L1.J1HMdH3 %;He[A\A]A^A_]MH}1ҾxHMHH}1HUj+wH}H MH}HULA+HULMDEAVLMH}uiX1ZMGHuLE-J*E&1ҾxHMHUU H}L* H}#J1H}C.J11EIcH}A HM1ҾxHHUH}Lh*HUH= .JK H= P.J1.?f.JH}IIH= mK  LH)HcиHUw.JII'H=s w.J bR fUHAWE1AVAUATA SH.JH(dH%HE1HDžHHDžPDžDH;H(HPHtL;EJE1E1אHD@L觨E1DžH DžDžDžHDžHDžHDžHDžHDžHDž0HDž8HDž(蛴tK oA !+APuGHHH H= XnK1 HDžE1AE1HDžHDžHDž H=9 Xz[A.Jg@LtHDžE1E1E1HDžHDžHDž -J Ht&H -JHH HHP L H&H8H0-JL\ H H(lDHMdH3 % He[A\A]A^A_] _~} $HmDDO=q=6?yI虦DžHDžf]D1ADAD[#M!HPL諚 H H=j J1˥H賥H@H0uH0HifK1ҾHhH(+HHgHDH臋?f.ˤDžHD諤IH8荤H8HH= .J1 CH H`DžhH`#H= J1 H_DžIHu]HE(HH( H "H H HHˆE H11HH. sHwjMHHj1H1MЃ]HDjL(H11A.J2DIMeLpPLL_LpDžu" JLR!HHbHHE1E11HH`HDž`藉1H0tjLA͉H0D)DHXH`HIAHD9LDH`H11[H`Is MzMt9HPLHLWHH IH<HDžXHDž`HHXHLH`HMHPHXHHE1H8tLMA-H8DH`HHrAH8D9DMH DžE1HDžHDžweMreLHHE1HDHHrPMAH DHPAWH?HPLM%L H  1ҾjLVzLMAhl/JHDjHPAWH AE-DH0HQH8HH=- J[E1AE1HDžHDžH= nK1!lL %BLH5ɽ LHHHۃHҁH1ҾxHX H H=d /J1E1A ƅH=2 E/J`E1AE1HDžH= 1E1E1nKA%HDžL(HHA.J1H<IDžE1HHDžMH`H1ҾxHHHDž`H`HPjHHPH`<DžE1E1HDžH HHHPHHHDžHAHDžE1A`HtmH`HMHPHXHHKH8AH`L.J1H=3 fIH`MLAPHMHXjHH'AYAZHDžA.JHPH= H1MnKDH"JsIHL[/JHclLHIHLHH=' 0oK1AMH= ./J7IMLMASH`HXjHHH(A]A_oK1E1AHH= OHH1Ҿx H`DžHPHDžHhE1hl/JADDHjHHPAWAVH0AqH= /J1HPH= oK1AeH= XoKAIUc0JHAUATHUSHH8dH%HE1HEHEHEHEtHUe0JHuzH= `rK11E1E1?LLHH}nH}eH}\HEHMdH3 %H8[A\A]]f.HUȾg0JHmBHHt*HUc0JH9tHUe0JH$u H=Q 1E1E1`rKw3fHUȾg0JHtHIHtILi0JHIHt(H~LẄHuLH= `rK1ULHAWE1AVAAUAATE1S1HXdH%HE1HEEEE5EHEEHEHEHE蓠tg  /:uOHUH{1uD#AA>1:=E={DmEEtAq0JHEHtH=@ H¾rK1iILLHLrKIHH5 H D3 ELDEuLE xsKLLE1OE1HHEHLH}HHH}HEE1ҋUH}wLU>LUHIKEE1EU+}!JHLU!JHEE117LUHILHLU(LUL$LULfDHUH= 1E1J1E1E1H=~ LU ELULLHH}LH} XEHMdH3 %He[A\A]A^A_]qED@?%  tq ADD=)=};1 nfDYzJE11E1E1f.fDADE @fDE@{HU'fLE11E1莘EE1mCHEf.I:@D-A0 t@HEbf.1ҾH|THE;H8HuDuEnUH}r:HAq0J1DmIŃ}!J!JAHDHEHE1jH}1G^_IHLH>u:}u4}t.11ҾL-uL!i0JEyLLmLUH]HMLUlm0JHtKLUiH}LULUHHE1E1fD1LmLUD]EH=ۯ rK11E1E1E1:EAm0JYN@SsKLLLLJHHEHL H]LHsKH=A 11E1mE1LPIDMMLt0JAJsKH= ELD1) Evq0JH{LUH]HEZsKH= 11E1E1LU%I-LHH_LUHIHLUSLUH=H tK1LUpLU 1ɺHH%LULLUpH= tK1-LUgE1_H}i0J~LU8tKH= E11E1LU#H= 1LUE1sKE1LUuH=v tK1LUH=Z `tK1LUE1E1fUHAWE1AVAAUE1ATISJHdH%HE1HDžPHDžXHDž`DžDDžHDžLrLߺL蔊1E1DžHDžHDžHDžHDžHDžHDžDÖ+ %u{HHHruHJ11H=ѫ E1E1E1H# LkLHP7H{P<1JHX=1JH`DHMdH3 %gH[A\A]A^A_]G袕f.1蹐!HPL}E<HHAH`HXAD sH= 1J1DLA.JHXH*IM\m0JL ,HHDV8IHt 11LHE( !EH= x1J1H=   A(1JED 1ɃE1LLL HH L|HPHB 1HH HP"I1HHw L`MtLLHHe H upf1JHHL)p)E)E)E)E9 oHo H0Hp)p)UHE LHH=j 1JI輇H% |z teADft{-1E1E1H=Ч A]A]DDžIDž9H'裌Iӆ1ҾHdJHL1E1E1΍E1[fD苆HLf.[HDCHoA]HHH`HXtIH= 1J1E1DLA.JHXHO'IH=8 ,1J1dHH= Y1J1E1I5H= E1J11E1,H= 1E1Hhh1JLHDžhBLl1J1HhL,LJ1Hhz1XH1H=K jA!JD 0J 1JHEȃA!JԃH ~H= 1H=ޤ Lʾ1J H=Ť vK11A!1JH= 1JH= pvK11ffffff.U`LHAWE1AVAAUE1ATE1S1HHdH%HE1EEEEHEHEEfDkz%>uHUH= 1E1JE1E1H= LUE1LUL-LLLL=HHMdH3 %9He[A\A]A^A_]f g 8zx kACAA1x{_E1E1E1DUI==kd\f.AED諁HUľH:h"\D`L1E1E1覈E1E1vcHEf.K1ҾHDI@ 9@D5͠ @HUCf.EdEEILm0JH!wKIHVEdH= ='HL=> \LxK uL xKu~Lnm0JL;IMYuH}.IHE>}PUE1H8HuwDEEdnH8HuHEwVDUEIHUHuHzw0DME(yKH=˟ 1E1E1 uLm0JA2J"ILPIaUxK1H=x H=l 2J1i'xK1H=A 1E111LHHE)LUufELLLUE1LUnH= hyK1LU LU2LLLULUSLLU:5H=HLHoLUHIHLUSLU~{ ULLUm0J18LUHI}t1H1HLjE1E11LU1YLU^LHLU1LUkH= yK1LU LU/H= yK1LULUUHAWE1AVE1AUAATISJHdH%HE1HEHEHEEELcLߺL{E1E1HEHDžHHDž@EDžtHDž`HDžhHDžxHDžPHDžXHE+tW Au{HPۆu1HxHunDtEH`HhHMHU#H= 3J1#LEHMA.JuHXE1IMCuHPD)IHPHHHt53JLHELMH@HtB3JLLM^LMLM1ҾK3JLGLMEt/Dt11LLLMEULMUE1ۅE}!JLMA!JH= LE3J1ELMt 1J E0JHDʃE1LLLMH}LMIHtK1LH:1LHLuLMMtL LLH|LMLLLMYLMH= 3JLM}9 H yENHH@nHUH=u 1E1J1E1E1H=W LMALMLLH}L1HH}=H]HtH,3JHHH]HtH.3JHHHMdH3 %DHĘ[A\A]A^A_]}AD ED~m{wHUH5^]A2E1E11E1|fOfADE@E@ADDžtvHhLE1E11}E1E1vENHHHlgfv1ҾH:HEC+|Hx/SvHX;vH`#vHUH\ EusED tkH`HhHMHU]H=V 3J1E1LEuDUHMHXA.JYDUIRH`HhHMHUtH= 3J1AH=ԕ ,1J11E1E1E1ZK3JLLMwLM8{KH= 1E1LMH=p E1J11E1E1E1E11E111LLMLMHHHLM>LMH= 3J1LM+LMH= LMwLM0JJLMzK(LMzKNLMH= Z3J11LME1LMLM{KH=` 3J1LM\H=D 1LME1r3JiLMff.ULHAWE1AVAAUE1ATE1S1HXdH%HE1HDžHDžDžDž qDžHDžDžHDžHDžHDžHDžHDžHDžED}tI Q~. ADZ}u1x肹UHH4J aH4J H1ɾ4JHooHH) )0H@H1ɾB3JH:HooHhH HLpPHXHHtIIF(1ɾ53JHHoA6oA~HIV LHo4JHAoA^HIV 蹭IL4JHHH\LLEHL&.HLtH11Ҿ5J HDHHsEHDžD  2E1E1E1EB谬LI豬LLHHIHLAk!J !JHHEоE11E1HHIH= }KnH HNUfDHH= J1F1E1E1E1HDžHDžH= AsH3HHHCH7L/1(LLH0DHMdH3 %}HX[A\A]A^A_] fg% , ED==EDfڰDDžfDžiDžYlHGlHlENHHb f.蹵@lHklENHH7bf.;l1ҾH/HxLE11AsE1E1E1HDžHDžDkH/ H1cHH111A0|K4JIIIL!LIHHMMu=H¾4JH1ILH߾4J1M9M~A>;MMDHuJ4JHH= 4J11E1E1HDžE1}IL4JH5H?H HLp(fH=# P|KQHDži4JHe4JE1HR4JHAA4J HHHHt53JHHzKHHtHH¾B3JrHDžH=K |KyHDžt4JH=* 1|KVEtH85J>5J 莦LI菦LLHHH~HnH= l5J1WH11H"H= 1E1E1 5JE1HDžmE11ɾ!JHHHIH=" 1E1E1}KHEE1E1E1E1HDž 5JH=Ո FzKH=Ĉ 4JLAA4JL HHH=x L|KXH=_ 4J1E1^H=D 1E1E1d5JE1g=u`E11ɾ!JHNHHIPE1E1 H=ه E1E1E1J5JE1@UHAWD<AVAUAATISHH}A9A1IcLE~YEnE1I@IFM9t9IB3IHDPtXDHcLAuIFM9uH[A\A]A^A_]H= ~K1-iH= &6J1 H1[A\A]A^A_]@H= p~K1Eff.fUHAUATISHHH{HDPuH[A\A]]@IHtH uL=tHSI<$(.J1YAD$AD$tI<$H/.J1[A\A]]-DI<$J1AD$cf.UHAWAVAUATIS56JH8L>dH%HE1HDžXHDž`LHDžhHDžpDžT DžA?e JE1E1/KLߺ`LcE1HDžH(HDž8DžDžDž@DžHDžDDžLDž HDžHDžHDžHDžHDžHDžHDžHDž HDž0fntw  )   uhc1ҾH&H0Mnuf1iilTt u DžTH`LVH`H ƅƅDžDžH tH HhPW0Hh EO  HDž(DžPDLE  @ۀEAA6J肹H(6JHjHH(~ HDr HHHu2HHt&1Hp1HpHH Hھw H H DDE' DE H HDžHHHL`M, HHH0HH HHWHTHHO6JH= |H`H`HcTHAB3LHLhDAWPZYg7JH= HLHIcI4HHH9HH3HAL`t!LmH= 8K&HtHH`HH 7JH= t_fH8t6WH8HH(k6Jmf軼H8HuDH(H="x P8J1N!AxWD)HH(AH=w 6J11E1E1չDžLHDžHDž HDž0=ƅƅDžDžH=)w ~6J1U\D8HH`HHH 8D@6JA6J HELE H`6JMHH1Hߋ@HuH 8IHkHh"E11E1tzL11Ҿ L袿u11ҾL荿.H(LкAŅH(HPA9tfDL11Ҿ L(u11ҾLH(HRAąH11ҾҾH(HD贺A9TH= u 7J18DžLdԺHܺHHDDEEi@eH H袺HHHL%BLdH %BHPH5Qt LQH5Bt HBSH(P6JH=t H1KE1E11HDžHDž DžLTE1E11HDžDžL2H11Ҿ B0LHH=s 8JH1誵H H=_s 08JH1舵DžLk1H=+s ~K1WHHHhPHH`ADHPMAZA[7JH=r {QHLt K1HH|IH1HXH9HHIHՎLHHIHHH8H HHLHHxLHHHǹjHH;HH`vHLc1WD@HH`HXjAXAYEDEt?HdH`H`AHLH@rHH螵uFHSalted__H9HTHHH_;Th;7JfHH=HH HH=p 6J1@E11E1HDž8DžLHDžHDž CH=o E11E1 JDžLHDžHDž HH7JH=qo {H_'HH=5o 6JcDžLHHǾ%BHH5n H(E1E11ۉLFE11LH`Hc11AL%BH5n LZHX1_9D@H=dn E8J1臰DLHX*Hu E1tLD@H01HH`HXE1H`7JHH=m 1H=m BDžLDžLE118J1賯DžLH`I&DžL7J1E1RA-7J1I7H`D9ֿ ,7J1E1A-7J1IH`D9ֿ 17JT~6HE1HH7JB4(1ID9Tۿ BN7JHTHHh 7J~OA*H@L蟱u%THH聱;T 7JH=k 1E11E1@L$U7J'H`KHHHt"HKDžL1H`HfUHAWIAVIHAUIATSHIHHHHHEMݱA7M̅IHU~DD9Mc, IfA$I\$LHH[A\A]A^A_]@9~ٍH߹OH0AHc+:JHHtsIfD:JH0AHcGHIq@H߹OHƺ+:J0AHc`HHtI I>Q+:J>I1%UHATISHHdH%HE1H;t#HEdH3%uXH[A\]L9:JHH1mHsH{HuC7UHAWAVIAUIATSH(HHdH%HE1بbL/fDLR:JL1LS9L轨:HIHIM)AIcLLHr HHH1t tDfDHtH1HPLBƄ 3LC:JL119;HEdH3%u\H([A\A]A^A_]ÐH11L=PKL1ѩ0KL1蹩rfUHAWAVAUIATSHdH%HE1ëI軫I賫IMMHxFM=IEIuHpHu&)@L耧IIuHt>-uHpLLIEE1DDždDžhDžlPt<f)8u˃hPuKKH0HHu"zL踦tOHH3H]>-uHpH=e pK1H"HH=e J1H=e TL,L$LHxPHMdH3 %= Hĸ[A\A]A^A_]ftc}Plc9MlHpCADd@sDLH舥`SDLHh@L1\KL1D<1LH`LpLxLXAHp4D9aHpD\HIHHHLr:JLH1HHXLHHLHS<DhEDlEE111Ҿ HiE111Ҿ HMAąH0HYDžDDD8`lHDžPE1HP+:Jv+:JLdE11L HLcE11ɾLHAŅ@nE11LHp:JHc蘙E1LHHHP;E11LHApDDE:JLMlMa:J:JLIEHP1,lDžD:J1:JLHEID@EDD@DADXE1L;J1裣@Dt$;JL1|DL1>;JgEt+;JL1SJL1DDžDDD8~JL1H0J+:J1+:J1HA7H=` +``N`˾JL1蜢D4HHIL{:JLH1gGHEHEHt$.JHuH}HHt4JHuH}HHtm0JHuH}vHHtq0JHuH}OHHt:JHuH}(tjHH11HUHЅE1L$fDIM9rHEB<(莶HuH}HuLpLXLH` :JHcʕE1LHHIq_MLpLHLX`H0+:JHP蹢+:JL觢~#HPDDȃNJL1DHP>DȉDL1:JJHL:J1HHHLvHHHtP11HUHЅ~?E1L$ IM9t&HEB<(HuH}HuRHH11HUHЅE1L$ IM9HEB<(|HuH}Hu:JL1DdEc迧5HHu!H(HHH4LH uHEHu\DH]HEHEHEEDmE@H}Ht ?n+:Ji7LpLXE1HDžPLH`[;JL1,,[@;JL1ם";JL1ȝDXL;J1諝DL1>;J薝/H=J JL1q:JLT@tZ";JL1DD;JL1'D>;JL1;JL1DuH:JL1؜H}wLpLXE1LH`:JL1蝜,;JL1A胜9fULHATSH dH%HE17HDt]t8uL1@HMdH3 %H [A\]fDH=Y HھJ1 11b>H8IHtf1Hy;JMII<$Hum@HHI$H==Y H14JZI<$Hu%U;JHAVAUATSHHtxt 1ۉ[A\A]A^]þ;JHL`迾Ht݃xu׾;JHLh裾HtxuLp tb;JL;JLt;JLuH=?X L⾤4J1h;JLÀۅu\H=W Ht?LhuDH=W Ht LPu,H=W L;J1H=W HuDH=W LL꾽;Jϙbf.UHAWAVMAUI1ATISH1HHM1M8auH1[A\A]A^A_]@LPL9v1fxHcHL@tHLuHuLLL&H[A\A]A^A_]ff.@UHAVIHAUIHATE1SHt-HHL;JL1Ęg;JHAϚ[DA\A]A^]U1HAWIAVIHJ1;J?C ;J;JHHEȺ>J1;JA;J A;JHLɺ$>J;JIE1ؒA;J A;JHLɺ=>J;JIE1袒~nLLQ>JHtWMtOMtJ uALL\>JH\t(1h>J>JH߾;J?D1H[A\A]A^A_]ff.@UHAWAVAUATISHdH%HE1HDžx@HDž@ HHLߺLE1[-E11E1HDžIHDž>JHDž0>JHDž>JDžDž Dž(Dž<@9t//w$@LN 0 W9u1y4!Hu <MMLIHt8@;JL;IHbM)1HB 轴= uH=#N %1ҾmD1蟴 (uHK覎rLHHE.J݄H HXjI`jH0LHH(HHH0HxH( HH;IHL0HLLLIH HH LxH@H0E1n21E1=L H<>JҺ>JHDH=L ؄K1fDH=L L11۾JE1E1E1迎E1HDž(HDž HDž0HDžDž<;JL蔐L輐L贐H訐H茌H(вLزH0̲;JH 6HtH)诲HMdH3 %< H[A\A]A^A_]@ +H{L&21E1E1E1HDž(E1HDž HDž0HDžDž<DES%h Džf I Džf. , @Dž<;*HHL*>JHDž(l@)H0W)H?)H'2GAf )I{)HE%+   @ @ @ @ |@ l@ \@ L@ <@ @,@ y @E%` E,%H k(I[(HH C(HH  @ @ |@ @l@ \@ L@ <@ ,@ | @ k @ [ @@ K @ < @ , @HDž(1E1E1HDž E1E1HDž0HDž`G tMH=G Dž<+&?JHE 7>JH=;G @J1g뙺>JH=!G K1ME1E1HDž(E1HDž HDž0HDž>J묺 ?J륺>J1L购tH1貭DkF E2H=F @J@J1貈`DH?J.HDž(E1E1HDž HDž0HDž2H=E 1E1E1E1HDž(E1HDž HDž0HDž2fDHDž(E1E1HDž0H=E 1E1E1,?J辇HDž(HDž HDž0rH=YE @J@J1耇E1E1JH=1E f?J1E1ZH=E 讉LE1cH=D @KE1E1'H0H=D E1E1H?JHDž0h>JūIHH LHLHMHx<HO t HDžH1HH-HHHJHHH]HHSHH9?HHH@軪<E1Hc;JH躇d;JL訇H蜈=C 1E1H=&C pK1E1O$UHIH HǾ?J1"u41H12LE1W,H=B {?J11 @JLۄt1KLȄt1@JL资tH11@JLHH葄kHE1E1HH@LD1LuHH.11H@L耆H1HDžJHDžJHDžJHH=zA L@YHJLHL W@JLH躨HL _@JLH萨H LLgH LHHcH_tHHx(G8HHxP/H@J!HA"D HHwIMtfLHxLEH@HL=? H= @ @J17Dž<1KH=? @J13Ik% 8HH=? @J1o@J́HH=? z@J1o@J訁HH=]? i@J1o@J脁hHW@JL苦H LLbH LHH^?H=> 0KHE1f+H=> ;@J1觀H=> ?J11E1πDž<:HH>J蘄Hh>JH‡HH\>JbHHH躖IHt'HH9uHLH}#H== K1Hߺc;J1$LdE1;JH=l=  >JRH== KE1H=w= ?J1E1H=_= ?J1E1kH=D= KE11mPH=)= ?J11E1P3E11)UHAWE1AVE1AUE1ATISJH8dH%HE1HEHELߺLHE1E1HE ' LuǿL1E1E1"E11ˀLLLÚH}躒LH}EJ_HMdH3 %He[A\A]A^A_]'6A1ҾHI*&fEJF!~ L AbE1E1E1~fD=!=t1ADD:^맻fDHUH= ; 1E1JE1E10}H=: f.KHE2fYc!3@#I IHuL 11HMLgLA2Jm0J1UH}IOIHLˡE='VIVLLHIHL>}LƛUپm0JLIHHuHU1E1E1HL1 ZYDH=9 K{H=q9 J{E1 L'xKH=<9 1k{H='9 K1E1P{H= 9 pK18{zfffff.UHAWAVAUATSHH?t)H=8 8EJ}H1[A\A]A^A_]HLLMIIAMLMȅt=L3IMtLLEu;N~;L+H[A\A]A^A_]LLL"IDSH= 8 LxK1IzH= 8 |L蕖H1[A\A]A^A_]@UHAWAVAUATISHdH%HE1HEHEHEEDTJH`ߺ LLdHh{HHDžtE1E1E1HDžxHDžPHEHDžXHEHE!tg f8ZuGHUH7)!uD1IL]t*MSH}]EJH=k6 {HEE1E1HvH=I6 zH}yH}ŔH}輌LԀL̀H}H}SEJPzLH{HMdH3 %He[A\A]A^A_]@O (  ޴ qgHh1E1E1H=i5 JwHEf.?!xHHuf=)=`HEWODADDžtyfHP_H˘IH?f.\!@HE f.HXttfIfD L~iPHxHH`HH藓IHH胕~~LWIHtnH=3 K1uIHtSA/JfDAFw/DLJLLPEJH=33 EIE1]uI(IHuL詑HE11E1ysHE@6 fK1ҾHHE+HxHEE1E1E1HE*Hxt1 OL`HUH}tHxIgH}E1)DH=rH}HI讄~]AHqD9LPHuLvgMDtEH=1 K1s6HhL1E1H=1 KE1sH=1 vHE!6 JLHEP|LEHIH`L1HLHLHEuH}LH5HuH&H}IMLݒH}谇HXvIH@11ҾHyD H}EH5(0 ;tHxH}-HEHHuLđERHKpUMthHuLt*UhHuLÅt?1Q8tHU@KH=l/ H1q{8DHUpKH=I<$HH[A\H]CgUHfHATIIJSHPH= dH%HE1)))))_ML褆HH詆H=b IJH1_H蛆HcH=< IJH1]_L腆JH= IJ14_HlHHu`@HEdH3%HP[A\]ÐHHLHHHDžuhH(H;HtIJ"ctCƒt S tHCHxHsHO<DHL]@UHHHH~\]@UHATISH>^HI<$HJH҄H[A\H]eUHAVAUATSHD(HI8HH=g HھIJ11]7LPDHLL[LZ9L5 IHt HĄtȿ@I膄IHtH¾PIL讄tH= IJ1\H= LHL0H踃H= IJH1\d DL\HtH=` H¾IJ1\LIKHg7L?ؑKHM7L5JJH37fD[LA\@BA]A^]skH= [IJ1A\A]A^][DH= HھIJ[H5 D˃(fDUHATISH>较H薂I<$H誃H肂H[A\H]bU0DHAVAUATSۂHH=+ Iž0JJ11J[5LDHUL轂L`YLX9LXH5 IHt Htȿ@INIHtH¾PILtH= IJ1ZH=x LL訂H老H=Y IJH1zZ, DL贂HtH=( H¾IJ1IZL衂KH/5L藂ؑKH5L̀JJH4fD[LA\p/BA]A^];iH= [IJ1A\A]A^]Yff.fUHATISH>H膀I<$H HrH[A\H]`U@DHAVAUATSˀHH= IžIJJ11:Y3L꾐DH赁L譀LPWLV9LVH5 IHt H|tȿ@I>IHtH¾PILftH={ IJ1XH=h LLHpH=I IJH1jX DLHtH= H¾IJ19XLKH3LؑKH3L]|JJH2fD[LA\-BA]A^]+gH= [IJ1A\A]A^]Wff.fUHAWAVAUATASH(udH %HM1HEL5 ME1FNM1If1LLHpkHEfH}H2MH0LsMtnD9#uAAtUH= D}uEtJ1VH= HKUľ\JJ1H0AVLsMuEHEdH3% H([A\A]A^A_]0Ie0LLHqHEeH}HuVML轺HUH= &fHS4J1UCjfD#lfDHuFNL5K MPf.H=i YJJ1ULhHZ%UDUHATISH>>~H6|I<$H*~H"|H[A\H]S\UHAVAUATSHDx|HIW/HH= HھIJ11TA/L0DH}LI|LRL=R9LkRH54 IHt H}tȿ@I{IHtH¾PILn}tH= IJ17TH= LL}H{H= IJH1T DL}HtH= H¾IJ1SL }KH.L|ؑKH.L|JJH.fD[LA\PBA]A^]bH=! [IJ1A\A]A^]ESDH=  HھIJ,SH5 D|(fDUHATISH>~|HyI<$Hj|HyH[A\H]ZUDHAWAVAUATSH%zHlH=u IžaJJ11R,LDH|LzDLPLO9L+PH5 IHt H{tȿ@IyIHtH¾PIL{tH= IJ1QH= LXL{LIU{HxH= LuJJH1Qf 6Ln{HtH=b H¾IJ1QL[{JJHi,@HL2B[A\A]A^A_]`DH= HIJ1[A\A]A^A_]Qff.@UHATISH>zHwI<$HzHwH[A\H]XUDHAWAVAUATSH%xHlH=u IžJJ11P*LpDHzLxDLNLM9L+NH5 IHt HTztȿ@IwIHtH¾PIL>ztH= IJ1OH= LXL zLIyHvH= LuJJH1Of 6LyHtH=b H¾IJ1OLyJJHi*@HL`3B[A\A]A^A_]^DH= HIJ1[A\A]A^A_]Off.@UHATISH>~yHuI<$HjyHuH[A\H]VUDHAWAVAUATS1H#vI)LDH+yL#v LLLL9]LKLH5 IHt Hxtȿ@IuIHtH¾PILxtLxH= JJI1 NM H= LJ1MH= J1MH= JJ1MH= JJ1MH=} LLxHtH=^ IJH1M1 L9xKHW(L/xJJH=(L%xؑKH#(fDHL3B[A\A]A^A_]]\D1LJH= JH1LUHATISH>wHsI<$HwHsH[A\H]SUHATISH>wHfsI<$HwHRsH[A\H]SU`DHAWE1AVAUATS1HsI&LPDHHwLsfDL@JLI9LIH5 IHt H wtȿ@I.sIHtH¾PILvtH=k IJ1AKH=T LLvH\rH=5 IJH1VK @LvHtH= H¾IJ1%KLvJJH &LvؑKH%@4BL;ZEtH[A\A]A^A_]H= HJJ1[A\A]A^A_]Jff.@UH񺀾DJJHv]UHATIJJSnHt xHt[A\]@A$H= )HSJ1!J[A$A\]J1IH= UHATISH>uHpI<$HzuHpH[A\H]PUDHAWE1AVAUATS1HqI#LDH8uLqfDLGLF9L#GH5 IHt Httȿ@IpIHtH¾PILttH= IJ1AHH= LLLtHoH= IJH1Hh @LtHtH=d H¾IJ1HL}tJJHk#LstؑKHQ#@5BLWEtH[A\A]A^A_]H= HJJ1[A\A]A^A_]Gff.@UHATISH>tHnI<$HsHnH[A\H]NUDHAWE1AVAUATS1HoI!L꾐DHsLofDLELD9L#EH5 IHt H|stȿ@InIHtH¾PILfstH= IJ1AFH= LLLsHmH= IJH1Fh @LsHtH=d H¾IJ1FLrJJHk!LrؑKHQ!@5BLUEtH[A\A]A^A_]H= HJJ1[A\A]A^A_]Eff.@UHATISH>rHlI<$HzrHlH[A\H]LUDHAWE1AVAUATS1HmIL0DH8rLmfDLCLB9L#CH5 IHt Hqtȿ@IlIHtH¾PILqtH= IJ1ADH= LLLqHkH= IJH1Dh @LqHtH=d H¾IJ1DL}qJJHkLsqؑKHQ@6BLSEtH[A\A]A^A_]H= HJJ1[A\A]A^A_]Cff.@UPDHAVAUATSKkH H= IžJJ11C%LDHpL-kLAL%A9LSAH5 IHt Hptȿ@IjIHtH¾PILptH= IJ1CH= LLhpHiH= IJH1BMD[LA\`6BA]A^]+RH= [IJ1A\A]A^]Bff.fUHATISH>oHviI<$HoHbiH[A\H]IUHAUATISHHH>UiH;IJiLHFt H[A\A]]I<$7iHhH;I$iHhHL[HA\A]]IUHAWAVIAUATSHH$I,HIhIQLLLoI#QMtLoHouH[A\A]A^A_]HL?HH[A\A]A^A_]nUH= HATISHtIHt<`H= HEu$H`[LKJHA\1]@fD[A\]HuϸKJH[LHDHA\]HD1HHKJ@ff.@UHAWAVIAUATSHHIHI![IOLLL[IOMtLVHmuH[A\A]A^A_]HL}>HH[A\A]A^A_]SVUHAWAVIAUATSHHDILHImI9OLLL[fICOMtL&fHnmuH[A\A]A^A_]HL=HH[A\A]A^A_]eUHAWAVIAUATSHHIHImINLLL[cINMtLcHL[=H[A\A]A^A_]HH[A\A]A^A_]of.UHAWAVIAUATSHHI HI]IMLLLRINMtLRHNluH[A\A]A^A_]HL<HH[A\A]A^A_]RUHAWAVIAUATSHHdIlHIkIYMLLLkIcMMtLgHkuH[A\A]A^A_]HL;HH[A\A]A^A_]sgUHAWAVIAUATSHHIHIkILLLL{kILMtLgHnkuH[A\A]A^A_]HL];HH[A\A]A^A_]SgUHAWAVIAUATSHH$I,HIkILLLL kI#LMtLgHjuH[A\A]A^A_]HL:HH[A\A]A^A_]CgUHAWAVIAUATSHHIHI]IyKLLLK]IKMtL\HL;:H[A\A]A^A_]HH[A\A]A^A_]lf.UHAWAVIAUATSHHIHIjIJLLLiIJMtLfHiuH[A\A]A^A_]HL}9HH[A\A]A^A_]fUHAWAVIAUATSHHDILHIiI9JLLLiICJMtLfH~iuH[A\A]A^A_]HL8HH[A\A]A^A_]fUHAWAVIAUATSHHIHI!iIILLLiIIMtLfHiuH[A\A]A^A_]HL=8HH[A\A]A^A_]cfUHAWAVIAUATSHHI HIhIHLLLhIIMtLfHhuH[A\A]A^A_]HL7HH[A\A]A^A_]CfUHATISH^hu [A\]DHLU7H[A\]UfDUHSHHHtzSHH߾KJH[1]8fKJHHHDHHDH1[]HHKJ8fULHAWAAVE1AUE1ATE1S1HdH%HE1 ƅdH(ƅhƅtƅ8ƅƅ@ƅƅƅ<ƅƅXƅpƅPƅlƅ4ƅƅTƅDƅ\ƅƅ|ƅ`ƅHDžDžxDžDž]w x 9  ADLjfDDžAI~%1ED_IEDt@89ED=D/0ADLj!B  ADDH(H=z J15HMdH3 %Q!Hĸ[A\A]A^A_]@#|=N'?ƅ$@Džƅ@ƅ|@ƅ@ƅ@Džx@Džfƅd@ƅp@ƅlt@ƅ\d@ƅtT@ƅ`D@ƅh4@ƅD$@ƅH@ƅP@ƅX@ƅT@Džƅ<@ƅ@@ƅ8@1`|AAHAAɃ ʋD ‹A ֋\D D 艅|`kAAŃAA\DžAH= EKJ12/.J H= OKJ12/.JH= J12%H=n J12H=V (K1z2H=> dKJ1b2H=& }KJ1J2H= KJ122}H= KJ12EH= J12-H= J11H= J11EEH= J11DYHHHH=W PK1E1x1 LHDHL`LXD@AL.A9DL/H IHtH!XHHv5uL XH= IJH10LWHWH= IJH105p hL`HtH=l H¾IJ10L`KHs LWؑKHY L_JJH? f.L1~SH ƅ4@ H=lm H HsFNDIƈ3Hf.H0H{H/L6uHD3LBMTIHAH HMtwLK HMtQH M@HM@u+HMt":tɸ->KJH= D1.HHHuH= 9KJ1. |AAŃAA\EAH=> J1b.=D3H H= K17."EhA1]KJH1]KJH1]KJHE\D`EA@A AFH=w J1-JE1EPTA4A   | ȋl ЋP  ȋp ЋXD  ЉĈ|AAAŃAAA p@lEDpeAmHH6BD;\D`EA@A EH= J1=,EDH= J1A,TA4A   | l ȋP  p ȋXD  ȉĈ|AAAŃAAA p@lEAH= J11+\Ep[EAFfDH= J1A*DžAFDAH= J1*JyEHEpAFEH=0 J1T* DE1QILDHYLQDLX(AL'A9DL'H5 IHt HYtſ@ICQIHtH¾PILYtLYH=x JJH1)HH H=N J1r)H=; J1_)H=( JJ1L)H= JJ19)H= L蚩L2TH PH= IJH1))BLR8lu | <% ȋ Ћ%  Ћ@% ȋ Ћ8%?  ЉAŨAAAǃ AAA@EX 7EEH= J1'ERth% Ћd% AĨAAH= J1.'H= $MJ *H= :MJ)H= @MJ)H= FMJ)H= KMJ)H= QMJ)H= VMJ)H= \MJ)H=o bMJ)H=^ hMJt)H=M pMJc)E1H= J19&EU EEH= J1&H= H= KJ1%H= KJ1%E_th% Ћd% AĨbH=& J1J%H= MJ)(HHHt2@HGH= 4JH1 %HbHHHuEAAvDAH= J1$|AAAŃAAA p@lE+E AFprH= J1@$kE l|<% ȉ Ћ% ȋ Ћ@% ȋ Ћ8%?  ЉAŨ H=> J1b#DEE EAADA@AEAEH= J1"3%IH RH3HHD1HǾ{La.HLL1ɾ|L?.HHcxLᾋL.H LHHHII L9LFLE1HDMADLI:KJH= H1!I9rDMAHL9vNHDMAf.DLI KJH=p H1!L9wыEH,LERaE H= J15!DHIHt 1H¾D4QLCH= IJ1 th% Ћd% AĨIAAVE$H=W J1{ 1E1PADž%LL;JL1; 9 Ik5I15I(Lt11L,P;~&L\KJHcAIHt|LLOxuL%_ M6LL&#MLLMJL1[fDH= LLvMJ9H= IJ1!kKJL/!" H= J12OH= IH= KJ1H= bLJ1H=o pLJ1H=W LJ1{&H=? LJ1cEth% Ћd% AĨAAE|cKfH= J1`AAA@ E-`HT4  | Ћl ȋP  D  ȋp ЋX ȋ DqĈ| |AAAŃAAA p@lDpA1LXHH=2 J1V|lH= J1*DžHsLIHt8zKJLL1`DLKzH= |J1<% ȋ Ћ%  Ћ@% ȋ Ћ8%?  ЉAŨAAAǃ AAA@E H= J1AFYH=m K1 EAH=P J1tpuEPlAFH= LJ11LAHLp(!f.H= LPKL9tLHI@H= KJHI11HJH>oH1oHW@JH))H k>ooHHSJH(8HHG8oH1o_@JHH)P)`Hp=ooHHx}HE8ooHH)E)MHEHHL=IH}=Lm=HHxPU=t)JJH= LJHD1 HHxx = L:HLJHHH=e LJ1_HH=F LJ1j0LhH= xKGpK16H= lH= H¾J1Dž`H&H= LJM E1LL[GLHHYG+H=w LJH1!KJu*KJH=N 2LJ1InM9uH=% IJ1QHIH= LJE1*F=+H= LJH1+H= "LJH1AFA9DFLHIHHHqFlHH=V LJ1z*KJ!KJHDH=. 2LJ1Rg*H= GLJH11HHH= QLJ1#H= IJmDžE%\ DžKDCH=y IJHH=d LJ1D艝MHAH=) KWHDž2KJ2KJth% Ћd% AĨEAFE^DžbAF|b<Ƌ% ȋ%  ȋ@%  ȋ8%?  ȉAŨAFE{DžDžE\`D|AA@ E=`AVTA| ы4 l  ыP D ыp X Ɖ|DžD\AFDpAFE3Dž7DDEEE AAAD@A.XAFl|[AFEDžltAFESDžWEDp AXE_X]fXE0EtXEtۋXEAAEUHAWAVIAUIATIHSHNLHCI<$L|tgHJLJLMLHHúHJ1/I<$H tHH[A\A]A^A_]DHߺJPJ1Df[1I$Htff.U LHAWAVAUE1ATE1S1HXdH%HE1HEv.J IHEHEIǐ۶uu'H}<藫H}H uH= LJ1E1'HEHEHEH= ^PJ L)PJLPJLH} LH}H}@2H}'2HMdH3 %HX[A\A]A^A_]=DY=Au9L纃PJg肪EJH}HqIH=@u=Eetk-HED@6fDL}PJJH}HIHW˩HEf LE11HEHEHEV@HEE1HEHE[HEHfDJf HE@HEHEH0Hu<HUHuH/HEHVHI/HEH.H}tfDL1E1E1&E1nfDI ӤI1rLNHHEmwLNLEHI6;8LEHIV LEHID$u%I|$HLEOLEȅ111LLE7LEHuI|$^LEȅH=s LL򾘗KH=\ LEF111LLE7ELEHIuC@D}I|$LEDALIHLL6D}LEI|$LE;ELEE1LLLE1$7LEH= LL1KLEȻH=z LEd@UHAWAVAUIATASHH8dH%HE1HHDžHDžHDžHDžHDžHDžHDžHDžHDžHDžHDžHDžHDžMJHDžDžxHDž,HHHHxKHHKEJE1E1;LD@L dE1E1H HDžDž`Dž8Dž$DžPDž`DždDžHDžhDž DžXHDžHDžHDžHDžHDžHDžHDžHDžxHDžHDžHDžpHDžHDžhHDžPHDž(HDžHDž@HDžHHDžXHDž0HDž HDž(HDž0HDžHDž@HDžDž8HDžf.˪<!B   3HDž8E1E1HDžHDžHDžHDžHDžHDž@HDžHDžHDžHDž1HDžHDž0HDžHDžHDž(H=" H@LAH5HiH=H1HUHIH=HHHHH0Q H% H( H H1L1H1HHH-H!Hp:BQJH:QJH$QJH8HMdH3 %Z#He[A\A]A^A_]fD2A ) -q /0 趜Hpf.LD菧1谢q 8ZH0tH0HHHDž(HH`MARJHLD11.8HHH11A2RJHE4Ht%H11ABRJHDH11H'HE111A_RJL<HHHpHHp1u H0HSHC AH(t7H=f gd9H5L K1{HpH HDž@H hLHk8fD1/HfDoHFQJGQJHHQJHw蒐HE1HjLHHjHxR1 H  HHHHHHUD+7I Hh0ID%]#H(D:u6DJ4 V'!dHHՅ8<H`=D)=A;uYH8=c/HI`f<貎HHSfD=耎H DDž`fDA}DDžhifDžXQDždADžP1Dž`!Dž$DžHDž DžHL#HH@QJH= 1EDž8E1Dž8E1E1HDžHDžHDžHDžHDž@HDžHDž)fD=HHHHpHH"BI I蛌H0背HkHSH0wH%-HH>FۑHHH@H8H"H@H@Ht!H81H/HHHHHH8F!L8HLHHHlHH!H'HH8Dž81@LE1#Dž8@ۊHÊH諊H 蓊HHIcAQJ11H|&H@H HH@H;CfDH'軂8Ef軉HH裉HP苉Hd@SI{Hk3H6H?ӎHA0 J11H %HH HHH@HoH@HHHH"kHSHwIg8ݍHH|Dž8'EL}1LHIHHHǃLE1AEAL9|HDžH(H PHXHpJHDHHHH= WH(HHDžE1E11Dž8HDžHDž@HDžHDžHDž0H) H=* KE1UDž8HDžHDžHDžDHH3HuHuHH= XK1E1Dž8E11cHHlHE1xLLHHH8%IHcdHL@AWHHMHRH8hRJHPATh9SJAUiH@IHLGHH fHHwfDH H= xK111CIH=\ 1E1E1KHDžDž8H=) J1UDž8E1E1HDž@HDž1HDžHDž0HDžH?IHDžALlHHHHn1f.HHHpHDžHDžHDž0HPH[ rH-HH?1ɿ0UHAWIAVAUATMSHH(DDu EndH%HE1AE11AAFDFHFH:I?DHO1 HHRI?LIB?LBIB?LBIB?LBIB?LBIB?LBIB?LBIB?LBHIB?LBIB ?LB IB ?LB IB ?LB IB ?LB IB ?LB IB?LBHIB?LBIHH=vƃA;AAF HM/9HAHDžXJHHDž@LLHHLHHMLLAI!%t¿N ADIWLD|@ƾxLIyH|M)N`|xLNLDž|LN0N H!%tDHJHDщ@K/HNH9aIHH1HHHLLLLlIHGH1HHsL HLHLLLLuLHLHTL1LH0DLHHH9;HHLII)L9sHH0LuLHE1HDžLGfDAA;JIH߾WJHD3H‹MuuItEHHھXJL1(H]dH3%NH([A\A]A^A_]fDEtt H4JL1f.IJHHXI} HL1A}$'Džɚ;IH=ɚ;&HHLHHMLLAI!%t¿N ADIWLD|@ƾxLIH|M)N|xLNm1XJPHpO|NHp9|xLN%HDžE1E1LWLOWJH9 WJL' WJ11H= ȢK1HDž0JHHDž KHyXJHDHMHDHHHIf.E1E1E1HDžH=CЉ3LL1H0LLLtH1LLLt\HHSLMLMIH HHLLuMLLMHDžE1LH0LHHLNLtHLLI#HH0LtIAuHHLLE1HDžtHH0LLL#HsQMLLML1LHpLuLHWJLLHHH\HHH92AHpINHpHzHpL)HH IKJLHLH)H)DHI9rH1LHpHLRL0LILHHLLHVHuI1HpLLLL/LMWJLLHIDHHpLHMHHH0LH1HHH1HHHHH0LQ1H0LHHH9syH1L[H؃H6HH1}1fHH E1\HHOMLHLLWJHqWJL_1HNHHHHPƂN$HN560E Z 1ɉ?L@tHHuF[ 1 1ɉ?L@tHHu\2 G 1ɉ?L@t HHu3H ] 1ɉ?L@t HHuI^ 4 1ɉ?L@tHHu_5 J 1ɉ?L@tHHu6K ` 1ɉ?L@tHHuLa 7 1ɉ?L@tHHub8 M 1ɉ?L@t!HHu9N c 1ɉ?L@t%HHuOd : 1ɉ?L@t)HHue; P 1ɉ?L@t-HHu<Q f 1ɉ?L@t1HHuRg = 1ɉ?L@t5HHuh> S 1ɉ?L@t9HHu?T i 1ɉ?L@t=HHuUj @ 1ɉ?L@tAHHukA V 1ɉ?L@tEHHuBW l 1ɉ?L@tIHHuXm C 1ɉ?L@tMHHunD Y 1ɉ?L@tQHHuoHH?LLHUHHWPVLLL"MHL8IE1LL#HHLl0: D 1ɉ?L@tHHuE1 ; 1ɉ?L@tHHu<F 2 1ɉ?L@t HHu3= G 1ɉ?L@t HHuH4 > 1ɉ?L@tHHu?I 5 1ɉ?L@tHHu6@ J 1ɉ?L@tHHuK7 A 1ɉ?L@tHHuBL 8 1ɉ?L@t!HHu9C M 1ɉ?L@t%HHuN1҉?L@t)HHuHH,ND@ULHAWE1AVE1AUE1ATE1S1HX dH%HE1HDžHDžPDžHDžDžHDžC]tWpyu\ufDWWH8IEpLv۸LDHƒ]HrLHHLMPE1fDHL LHHELSL{q HHATAVH uf    HPDžH-DHJH=p 1HDžE1H3WJ4WJLHHMdH3 %He[A\A]A^A_]=}=:c4TYA=DA-DADDž L1E1qVHDžfDEDžAf.fDx~fD`ffDEGNAH@虗).@ HGHKH HHELSLn H1ATHAVH mM XJc 0XJHIoubL=$o AN@LI:t{HI ESLn IHATHAVL1H uHDž @1E1YHKHDž1E1kq XJrIf.UHATSHdH%HE1HEHtDHIHھHEH}HHHuLHHMdH3 %u H[A\]îUHHAWAVHUHuAUH}ATSH(dH%HE1H=k GYJH1Hz}\H}HHH?HHUHuH}-H}īHK11H}AH}觫DIH=Fk L&YJH1lAEtAHA@}9H}HIHHHHt11H}vH} FI|$I H=j L/YJH1ЬLj}$H}HeIHHx谬I|$I裬I|$I薬I<$I芶MMLH="j ¾8K1LLtf.UHAUIATIS1HfHL`t111LHuمuH1ۉ[A\A]]fD蛴H[A\A]]ff.UHAUATISHxdH%HE1Bs$L@HFHx04JLHH1TWYJHbfHEdH3%1Hx[A\A]]fHFHXBLlfDkYJL1HI9uHFHXBLlfDkYJL1H說L9u]H~Hx蠨詿HxH}HHøJHDHVPHMHLqYJ1FJL17fHFeYJHH1DyYJL1跩U1HAWAVE1AUIATSHHuȾ4JɩDLLuL1YJ覩LYJL1臩AH}A9H}DEHIHI_ "JL1>vOLSJH1Lew1!fLcLH8L09|PH[A\A]A^A_]ÐUHAWAVAUIHATISDH8HUL}MLMdH%HE1LI-$ŠLWM&LYJLL>LE1I>fDDLHMHUAWLMAHL.ZYtALxA9| fwuM LAYJ LLL!HH&IHH"HHHYJqHLFHuE1E11LLLiL/AXAYFfDLHMPL^YJLLL~=L{IHHL$LLyL/f.M6L֣YJLL.H=c "ZJ1LH=c H诫H=c -ZJ1ܥLLHfHMdH3 %He[A\A]A^A_]@MLYJLLmUHuLnIHHLIHHHH貢YJHL L"HuLE1E11LL%L^_@H=b K1訤LH=ab HQH=Rb J1~f1fH=!b ZJ1MH=b YJ1-qH=a ZJ1 H=a :ZJ1H=a YJ1ͣL1HuHH}fYJL蓣1fDYJL{YJYJL1bDYJLKfDYJL3fDYJYJL1YJYJL1f.YJLâfDYJL諢fDYJYJL1茢YJYJL1l YJLSTfDYJYJL14S^YJYJL1 UHAWIAVEAUMATIS1HHUȉM:L覟HuMHUMEHLZYtL69¸He[A\A]A^A_]ff.UHAWAAVAUATSDH(H}HHUDELMHIƃE1L]ĞD9LDHxHuHuDHUIM1>DL薞HuHULMDHDEH}ZYL9|@BLίLAD9AL#BE褯EHe[A\A]A^A_]fH}IŅHH=] 1MZJM5fD1@H=] YZJ1ݟHC HtH@HxfH=] pZJ诟f.@BLEE4He1[A\A]A^A_]ff.@U1fHAWAAVE1AUE1ATISHHxdH4%Hu1)HH)HHDžhHDžpHDžxHDžɵJHhH"LߺLR:E11DžHHDž(HDž DžHDž0DžPHDžHDžHDžHDžpHDžHDžHDžHDžDžXDž@DžDž<Dž8HDžxDž\DžDžLDž4HDžHDžHDžHDžHDžHDžHDžHDžHDžHDžDcEt_~    I 2|  Eu1)@,B HH,4HtH=2Z )'JK1YHtH=Z y(JK17HtH=Y ZJK1DLEbHtH=Y iJK1HtH=Y )JK1HtH=xY )JK1蟛HtH=VY )JK1}D0EDPEDHESHtH=Y JK1+H(tH=X ZJK1 HtH=X ZJK1DXEd\\AD$vH=cX [JK1芚HtH=AX ,[JK1h8APDD!tH=W T[JK1 Etjt_[JHپE丕DDฒEƉHhH9"H{ZJHHEHH11HhZHKH=VW ( HU 4 HHHxHp  LxMB LDž4!HDžHDžHDžڃHHpAZJL HHHXpHDž@Ht*HhH1AJHLH@HH[DHLPH0H>HHuHHPrI'rLH\IH4HPHHHDZL7L7LHPHPLPLaH HLLHt*HhH1AKHghE15H(D諔HDAH蕔HHH(9D9HHHHttAH_XttH11ҾXA7u3HuAt#[JH?DEHx1Ht 1HH*pI2pSDh`YELH@HAWHHP\P8jPATH@HHHHtH<'AtE<HHHDE1PL%AYAZHIHtiHHDž4H֕HH~HrH@VH讙H=?R ҖE1E1)"XbA~? c1H'*1HfD)H1E1E1H=rQ JE1蝓Dž4HH +LÕLH(蟑WYJLmWYJHhWWYJHpAWYJHx+4HudH34%2He[A\A]A^A_]%~e'l0HD=y=&,e*u:/HQf#/H.fD+PADljP=F=Hd}zDž<-u3DžH@$/HfD..1ҾHH w=IEDbf.I:r:E1E1E1Dž4f.w'8A2.HfDڃDLE1E1E1$5Dž4Du[kED\@ u[Dž@D@sjuMAEE\\fDDDXADljXu&-Hf.-HHHƿ+JAlHH`蕕H`AKH=4M ZJ1`DžL!fDž8 Dž0Dž4Dž\Dž1HDžHDžHHD$+Hpw+HHHƿ+JDž9HH`bH`H=K ZJ,g[+HC+HH(+H(H._*Hxp*HxsA@*H'*H+0HHK*H3*H"H(HkD@e?HhH9kHH=EJ ؤK1qLH=-J ,1J1YHHHxHptLpHHHxHp´t4tLt.4LǺf[JL迬LHMDžH~H=QI [JK1xH=4I ZJK1[H=I 3[JK1>e_[JHWkteeJHAkD4E1H=H )JK1H=H )JK1ŊcH=H )JK1訊6H=dH JK1苊H=GH ZJK1nH=*H ZJK1QH= H ZJK14~H=G JK1S4H=G xK1E1E1E1PHr]IHdI$dLHHHHLHHoDE@L111HHH11HwH =t.OcIWcLf\JHwHHFA>>H11,&HE1IDHHRIHHAHHLxHZYH=E xKH=E pDž4nH=E D[JK1H=E [JK1ˇ H=E [JK1讇4H%lBH=KE M\J1wE1L@11L11L@HMHKH=D 1HDž@1E1HHDžHpHA[JHZtHj1Hu5BH肄HHH@謜H931H]L1E1퉅4H=D 8K1L.LHHDžDžLHDž@K1E1E1ۅE144H=C K11E1诅HDž@HDžH=UC N[JK1|61E1H! LHHHH衽H11H芚H=B \JH=B H越H=HHtH=B H¾<\J1E1谄HHt迎LcH1Ht詎HcH=GB LK1pHH1ɺ[JH6H=A 1E1E1z[JDž4sH=A E1E1TDž4RDž4E1E1=H=A 1E1E1z[J跃4HAZJHDž4HL迚uHH#H1҃LIHiHIH(WYJLHLjH=@ 1PKςHIDH)HHt1}HHH=N@ K11E1uL4HH ]HDž@$DžLiHhKH=? (KH=? Z@E1퉅4SH=? K1ӁWYJLE1H={? 0KE1要H=g? hK1蓁 \JH1IEHxI}AH=> DKH1€IMHtH11H~H=R> ,\JH1{L胶 H=/> K1[H=> 8KE1EH=> pK12kpE1ɃDPLA[A\ H== [JE1Dž4HH== KE1{H=|= z[J11E1ff.UHAUIATISHHtPHH }LtHLkH[A\A]]LYJ;H[A\A]]YJ1H[A\A]]ff.~LUBHAULlATISHHkYJL1H~L9uH[A\A]]f.ffffff.UHAWE1AVE1AUAATISHXdH%HE1HEEEXLߺLHEE11EHEEHEHEf.K& wX9HUHufH=q; HU1E1J}HEH}`L(H}LHMdH3 %4HX[A\A]A^A_]t"L1E1!H}HED W8ENAO+%1L $UH}rSHEHtWH}HŵXKHEHy}XH}11Hu訵HPH}UwH}IHETE}HL}<H}1f. \H}E1HE;ADE@HEfHUfEd@1ҾH<ID@HE2H}E1H}Hud2^JH=8 E1{H=8 Z}H}lH1H12H}H=8 -J1zH=8 }H}'HxH}t HG 1HHXLpHtNMEH}u'fDDHA!xJL$}HwA9|M U17LwIjLLH赔JL|Lpw9|DHwLHasJL|DMH3wDeA9|^DDeLDQwHjHLH+HLpJL3|DELv;E蓔xE1'DHAvLH:JL{HvA9|}tFEt/DHAvLH辂JL{H9vA9|hEt?DHAVvLHHErHELHhJL;{HuA9|uHvLIH`LL%JLzEHu;EE1:DHAuLHHEHULHЁJLzHKuA9|zULHAWE1AVE1AUE1ATS1HdH%HE1HDžHDžHDžDžDžHDžHDžHDžDžDž\DžxIHDžhHDž`HDžHHDžPHDžpf.tK vO8 SAu1eZNMtHL|<HhH`HHÞ\rHPD]H`H  EH`1׮E1ILxML LxHHhMHHLxLxHI=LxHhL衔Lx'D'~fHzE111҉ƿ\%HfHf. gyI==XCHHt <@LJ1H=1 sE1E1E1HDžhHDž`L&LΪHhtHHp*L{H`uN_JHpuN_JHZuHMdH3 %He[A\A]A^A_]fDQSB?D7%L1f71ҾHJHpfDADDžxfXq*@SHHH>fHHHH`HHHHGrf.Hf{HPcHH$HNfx0Hv\H=. Lu^JH1pf HhHHDž@HDžHDž H=. L⾓^JH16pIH5H$mH`1胩IMLMQLLxxtLxLLTLxI4HPLpAJH耭HHhH$IHnHH%IHCE=H=, EJ1DoE1JH=, ,1J1nH=, 1DE1EJE1nE1HDžhH`111_E1I#H=U, 1E1E1侰EJvnE1HDžhH`111!IYE1E1E1HEgHHh1E1PE11L]YLx^QGH=+ ^JE1mH=+ 0pLx8_J1E1H=v+ mH=j+ oLxHDžh1ɺ(_JLxHL`LxzH=+ z[J1>mE1E1LxHDžhnHHLMtLMtHHvD\xE11襦IMLMOLQqLLL聦IH={H=,* EJ1LxQlLxH=* EJ1-lLxsH=) _J1LxlH=) [nE1@H=) ^J1E1kH=) ,nE1HHh1E1PE11LLx1XLxZLL1肥E1LLLx1vLx^JHL8LxjE1rH=( ^J1 kH=( amE1KLLLx1Lx+LHxjH=( ^J1jH=x( mLxLL1¤E1Ejx\1谤IAR11P謤A[A_IUHAWAAVE1AUE1ATISJH8dH%HE1HDž8HDž@HDžHDž0Dž4Lߺ L~1E1HDžHHDžDžDžDžDžHDžHDžHDžHDžHDžHDžf{tg 8Ru71ҾHHu19 quEt)u 4tH=[& XK1hAD m AHH8H8u4H=% K1 hE1E1HDž@7 b  AD}D EDED_ 7H4H>fDHH= % J1E13gE1HDžH=$ LmiLL^HhH8F{HLRoT`JH@hU`JHHhHMdH3 %He[A\A]A^A_]f'2fED=txz@FNHHFfFDDžfDžDžqDža`FNHH?*f. L1E1 E1HDžHfDHkHSH;H0Hf.HHgAUE11#HtH=:" K1fdHHHHH@?H@0ELA`JH٢HH4HD迯IHHH E1ҋ iDE4= LPHLE$%L@H=! K1-csLAJH HH= ,1JE1bE1HDžH4J6HHNL1ɾB3JLL葂H ooHHpHPLLH()P)`MLHL<oLHHA!oHAiH IQ K$E1ErHHH8LE%APHE1E1P1LAYAZLbkH11LL15L@HHކIHtDLLLuR`JL1L`L)H11LL1'L~H=d `J1L`H=J bLLܚLfHPLIHMH(L1ɾ53JHLLLoLHLAoLAXH IP H= EJ1L_LH=o HaLjQHE1E1P1Ls^L_;HLL*L~LH= (K1 _L^!Alj؋WULHAWE1AVE1AUE1ATE1S1H(gHEHEt?60Ga(uHEu1:LrϥIH38HE8HM1LH贃HEHH}w脥HEHEMLH}LyIMZLLEq|LEH}aJ1]LEEHuH}11LE18|LE}fz1ҾH I{oHUH= J1]HEE1E1HEL=yH}]L|H}CeL _H([A\A]A^A_]f.Z=ADADfDIL1E1E1HEHE4E1H= eaJ[H= O^E1HEE1HuH}LEa{LE1H=y 1LEDaJ[H=_ ]LE5HE5HUHuHzIH=$ LED]LEbUHHLHLUL]tC~!tI tQtY1]D@t[tcuMH]rfMH]t@MLH]qMLL]qH]wMH]t@MH]t@UHAWAHAVdIAUIATLSLHHHEDLHHE HdH%HE19cAFA uX1#@zHcLLdÃLL\uHUHLE1uE11ۺGbJL[HMdH3 %HH[A\A]A^A_]f. JLÀۅ0 HcaJHHMIAA ]DHLD[A9H= aJ1X'f.1#@:HcLL4ÃALLI[uL1LLQtÃNLM>I?bJE1MLLIEHtDH= K1E1XjDDHLDZA9LL1LLMLysÃH I?bJsLMLLHHHL5sfDH=9 aJ1E1bWDH= )bJ1E1BWDH= K1E1"WzDE1mLHULLHrIVUHAWAAVA@AUAATISHdH%HE1HDžHDžHDžHDžHDžDžDžHDžHDž 0Lߺ@LHH1E1ƅHHDžHDžDžHDžXHDžHDžHDžHDžDžƅHDžpHDžxHDžhHDž`HDžPHDžHDž /  ED{t_ ?  ~u,Hx u@1AD9HEH:  AHDž(DAtuƅAX Hp11H(|Au A E1A H(GbJVE ȈDy A@FA ppp H؈pƅD1HDž-IŅ HiHdHHHLpHH\  A A AA  L1LV~HXHt HLK HDH2AAHDLD1AbJ1HIHyHnLHnHH:YVHnLH{nH= HپHKH1QLRHKH= 1QHDž1E1HDž8DD==R #EHYfE1HH= J1PHDžHDž1E1HDžHDžH=K ARHlHlLxQ1fHHRLXHXuGbJH/RvGbJHRwGbJHRxGbJHQHNHMHRDHMdH3 %He[A\A]A^A_]H =H~;=Jr=K=LgH=Fk/HDž1E1E1HDžHDžHDž*@ffDAAOA =DA-DADA DA DADADADDžfƅ@ƅ@ HXHoHH[fDHh?Hp'@LE11E1E1HDžHDžHDžHDžf.HC=HHNKH= +JOH"HHKf@HHg?f.2!o@HP{H`cHK1ҾHܬH+E1AHfD H+MHHDMHHHH=@ @K1E1iKH Ht AHu AKAHDž(DAtAH K1E1H= JHLmLKHHHE1DLLEAʼnXHD AE9taDLGHHIiZHL11H= KLE1IHDžHDž7DDLXHcH+GODE1ALLXHD\11HxH(q H(LL}H(GbJAKE9DHF:HI QHuLbJHVH1ɾHi GbJH MHH(HJH=7 +JLNKfAH'LdLL;QHH= pK1GA  A@~ Ac HdHH=m (K1GHHXHH-HΉlH4HH=  ubJ17GEH(L1A.JDH HIDH1AibJMH=HH5aHIHGMD11A.JLHUHIv bHHDDLXHxt A Hxu piADžHDžAA BH`4HhLH0K11H=Z E1EHDž$.JLcHH= @KMEHDžHH*AA WHHHM1jHMHbA[A]JM)LaHHLLrcHHH=p ȶK1DE1MLaHHtLjHHD L9uЀtHH@[A 6HcH HxHHH HbJ6HH 1H'HDHSLLHJZYH`wHDžIHDEAHhH=K11ALPrL興LHMt/H0hruH`H=OHHDžE11 HзKHH=@pK1E1i@HQHH= K16@~HHHM1jHMH ]ZYgL\VbJKH=HHDHH1?HDžHUQ6XHKH=PbJ1|?HhHw8HH1HEzA HAPE1LPHD1DHPjHeH THHLEyH E1H"HHHIDHAH==LbJLa>HyHyH~yL1Lxy^pHoy_LH=t.bJ@(H=@11۾K=/bJ@e=HDžeUcJ[2H{H1H H1LPLHDjHH^_H HtxHH(A ,1!LHHHHKxthKL1?(@KLE11?#{11H=FAtMccJ[?AQDL LHjjHH ]cJ?d>H=11۾cJ;pHxbJ11H=;O4?"AL? H=w >HDžDH=I;cJ1u;ULHAWE1AVE1AUE1ATAS1H(dH%HE1HEHEADTt2!huA"u΅v1?ECHEHE1E11DDHvH}E>IMH=/L11۾4JN:eJL\<@H}>H]dH3%H([A\A]A^A_]HUJ1H=9멐t;|)yAD}fDL1GHAAJAsIE'I4$HEtKЃ߃A<B< I$(eJ1H=8JHF w@HJЀ vuH}ttHuH=uXH}11t\eJtoeJI$_eJ1IH=6a8@H}CDHN@HЃ߃A<vB< H=dJ1 8 H=dJ17H=FeJ17.^IWH=dJ7xH=qeJ7bH=[dJ17J=7ffff.U@LHAWAAVE1AUATE1SH8dH%HE1HEIf.[cJ8'~Mu*1ҾH軗IfD==AD두uH=lL1E1JE16H=P8jJL8LL>HMdH3 %H8[A\A]A^A_]fE1E1vD;II@LE11E16CfDAIA>LE8AmUAxau AxxSAmLMLE@>LMLEH81HE<EIIDOuAKAMATHHULMLEE9HUHHcuLE(LMA0MHuLljM~MHUHHUt]HHH9iHHHUH9v4H=6pK1b4D1HE$ھwL{IH PjJ(H}Itf@HEAH=LFLuDu?1LLHo(tODLL7D9 HMH)Mu11Ҿ L:1ۅfE1 ID9u~C71 .JL:3tE1SAxHHEAGHHULMLEE7HUHHcuLELMh6Hp6HLHl6jJIZ'H}IHLMLEHUE 7 HUHcuHLELMeH=jJ1'2wH=HK12_E1sHHULMLEE6HUHuHcuLELMJL47t1@CkJ3H6H?8DU7HAWAVAUIHATASH(HMȹHDEDMH()Lt A|/ HDžMJHH=Y]kJ1}(ADHEDAHAADuAGEOATkJLHD4`MH1H5D _DAXEHD5DPI}HDAdDE D3HH$NEOPkJAGHLH4`MH15 XZWLL5 58LH軪ILkJH=H1&LkJ(LMHHNHHH=ec4D8DLH LkJHH=H1%&DJfIUH=kJ1HH%DH=HkJ1H%fD38]KIMHHFLkJHH=4H1b%DHLH6 J-IH111L@LIG'ML"蒨H=LHKH1$HH=nCkJ1$DžFLKH=<H1E1g$>HH=gkJJ$HDžDžL1"H8Ht^H"L1HUH5II8`DžuhH=+J##HxHtH{#L1HUH5wIIx+>DžtMPvYt 2L=HMLAADžmHqHHLHHHHH#Hf{HH;tQ=lJHH;tS=lJH]dH3%D!He[A\A]A^A_]ME11E1蜼HDžHDžHDžHDžHDž8HDžHDžHDžHDž @  y x ݴHѿf11>EHNHHHH?HD58HHHEH1HHHH9=HtHA8HH5HA cH`H质,H11E11AHH5<HH1H= HDH=tP11E11AHH5HH=1ɺeJHHH5oHDžH=HHDž8 JHHtHH H It>H5}oH=.D JDž0Ht!8yuxeuxsuxu Dž0HHHlLHA.J1ҋRHHH5nH=`HtH=W(K1HHDžH8H0 JHH!EHHtH=K1HmJH^H8H!HhH.HhA KH9KLDHLH11QHHH1&HHAmJ1LHHHH0KH=DD H8F"ER@-H8E111LAHLH5LHHtH=HHLOH=HtH8eJL~OHH`HH8)H8t A1ۋHtJHHH'HH8H*H= K1Tt( , DAHDHkH@H[wH@DYH H]%D+%}$LE$H LHHAą$,V$(HEmIMH oJ$.JL3/uFmJL"/LlJHHDž-E1H H/HH J@DTE H8H 4w#ME1\H=xKEE?.fDoYH {AH@*"*q~W N@蛬HH<jHHffDGAG*H&fD1.-+H۫1HaHH<@_F%~e(~:uHxqf_RHNfD&?2Hh.fD#7A@LDEDDfDE44fD8EEH8H/rHH HH0HDB tDHDB uHϾ=HHHI:I)HϺ=lJL'HHHHH9H0PH7DV utfDPDV _HH9uH=K1HH6 =lJHHH===2,H-f(,HH(JHuf0$DDD0@0DDD@1҃3DDDrDDž,YDž(IA=DDž)H1ҾHkHۧHçHX諧AHf@HNeHHvVf;H@7DžT!f HkH*HpH֦H=WlJH1 ;賦1ҾHDjHHHH=zlJH17 f+H`gSH8O;Hs3fDHc H HKHݥHHA軥HH蕥HHfkHHWf.HHHH=nJE1DDHztHr1Ҁ>+uHDHHASEERH 0|)ZY1H E>E18HhD20H8AHHHp%)AHhA9|HH8^S=ܱH(oHsDžP9DDLPPL79LeHL`H1LHHLhIIvqIL/nJHH wH t4nJH_tIK|49nJ>SK|,BnJ'I}I$fH=HupHEHtg&MLHEHIHt$HUHuHtHuLuIuHDP u7I] @HHMdH3 %u"H[A\A]A^A_]HDP tff.UHAWAVAUAATISHHHXdH%HE1LEHEEwLH L,/sJH1]LIHLILtJHH1*LtJHH1HEHELHݨLLI+JIMt LH¾DtJH1+JMt LqH1UtJH=ȊtFHuHULVH1dtJqUHuHJHHuHUL uytJH1&UHuHwJHeLHtH KH1}LvHHLHH= uJH1!uJH1HH12uJmHc=HuJ,L5ILjLE1jHcILLKZY^uJH1E1q~'DCT%17JHID9%H޾JH1vrJLsJH111Ҿ HHEdH3%FHe[A\A]A^A_]tJH1i_@rQ1LyHILtJHH1N@LXHEHFsJH1E1HELeHEAH}kD9H}D薾D]sJHI1LLIL1HHJHddsJH1eLIL1HHJH(LIHtoHIHlL|=qLyLHEVLELH߉8K1οE1ɺ rJLjsJH1調L2HH7{sJH1舿LpHHJHXDɆELH]pLKHH1LH螏Lf u  3d 8[ P˃O PǃC DGNfDDEt- @a b NHxD``P@HD B}xNH8@O9aDžw   (xDž Yf91Dž /'r#a+ " DžmX`SHpHrwH=mK1D/HHwJH=m1ů LIJ" LH@!FgA LH7  L1ҾH-HHH=lxK,H% ! LLHH@~fDX TRY[ KH:f.= 5 = T = {=  O88DOfV/ lKHLMH@W\Z%KHif= JH>fD=  = |HxJHxHīHtJx^tJH輵=Y{=I=ƅf==dibB,IH?d4@ /~U LVIH@NIHHWlI{rJHPH/HHDžPH~rJHbHPffD= Dž@7ME1 PHDžHDžHDžHDžHDžHDžHDžH=r9 rJH=IrDH蘶11HӫH BRHH`身A rJHC rJHάE rJH踬HlG rJHp薬H rJHP耬I rJHjJ rJHTK rJHx>L rJH(M rJHN rJHH8мHhT{HhHxHT rJH@EU rJH@*V rJH@HpH@ H=p{HHHqpdDH]dH3%yHe[A\A]A^A_]+') *(pK73@1EHH=?fK1c0M0@-lEHoHɈHH0HDNHuif5DH@;9bDž(H Dž,DžDž0Dž$"DD= DDDeusDž@==|~H80D$`\@>CHLH0!Hhy fD*D- D<2Dž(H Dž,DžDž0Dž$t@AGWH=c@K1败HDžAfDDžfDžDžDžDžDžDž(Dž,DžDž0Dž$fDž qDž(Dž,DžDž0Dž$9fDž!DžDž AXPHkKpDž\Dž DžXDž`ADDž(Dž,DžDž0Dž$IfDžd1E1(Dž(Dž,Dž0Dž(Dž,DžDž0Dž$f&k6JH=`AH1HDžPHDžpHDžHHDžHDž@HDžHDžHDžHDžHDžHDžHDžxHDžhHDžHDžHDžf.DžDžDž(Dž,DžDž0Dž$yfDž aDž4QEHhKDHhH*>HhHҟ DDžDžHhH=^K1(oH=^K1HDžx1iDl0D EDE/DEtHmH~0uHxHpHtLx1HHxHLlLAL9xtrJLGH9trJH,HugKE$H4HxLHMHrJHHHHHxrJrJHHѣHHHH1HHx7H9xtrJHL9trJLHPHt1HH|u $HxeHNHeHgH811HHX11HpjHptHHL@H1AKDHHHZHxH@ALvJHHHHt*HH1A_vJH`PHPH*J1HHPHHHHQHhnPH=%dHP11HpwH wH HH)HHeH1ɺN HHhHH{HHtHHH0~-`-d- ---d~HHctH-L(QL HHHH@PH0{H  ,Ht7MHH-HHR-HHKHHt#HH@+H\H=$bd+=b?+H=F谦H*H6 JHH*111HHH}a舜H=pa*H?FHHtHH*HhHt H^kH=`tHNHeHtHXHH=FHt E1DžE1DžADžDžHDžDžDž Dž0L1LIHHHHH9uHHHHH9u)HDžH) Dž0LLL J$#u2At,XMHHHH  #HH߉HHH⋍H 0u(t?x#HtH߉fHHHH ŀL(1HHXMH*H,Dž HHHHHHHHHHߺ@EA< AAAAA @_DOA HH9@-@.AD <.A| -<-1AHbH=<.rLK1H7H=.RpH=.rLK1H7H=-$pH7H=-HK1Ao^Hc7H=-K1Ao9HHH1=H?ƒ!DHDžuJH@KbH KQH=6;H=6>(H=6K1?oHžvJH=,1oKH=,AnH=,OqH=,KAqH=,'qHkpH1ɾ4MzHKH5AH==,pn%H1ɺ!zH8H諳vJRH蘳*H1ɾ~yHI@KHO5AH=+mH1ɾ}_yHKH5AH=O+m7H4H=7+پpKA]m@BH|vJ輱HpIHLHpL@LL8~3uAUHDPtAUDPtAUDPtA} u 11LtL?LnxJHPpIHLHE1A@pH@LlwJL1Ml11Ҿ Ls H8.t;H@L*HwJ8胇HEE811Ҿ LBsLjL"nEuH=)K1kxJL1kH@LWnvJ1MAH=C)vk!H$oIHtLH!oA~-uL@LLAHu HDžuJL HwJL1j11Ҿ LCrE1A Hx-u;H@LdžHwJ8 HEE811Ҿ LqLLlEuH=+(K1WjwJȮHnIHiLHE1AmH8H@HL~ ;"11Ҿ LH8SH@Ld^4HVTN9 Hy   H9,Hʀ<uI9B HJH<HcHD`L$@Md11Ҿ LhݥHeIH~LHAewJL1)a11Ҿ LxhH@(HHH0DžHHHH90uHHADLtHfoxHLH1H 1)gHu11Ҿ Lg L@LLa|8~V1H"xJLуu;DAAAaA11Ҿ L@gLhL bIK1MAH=q_OHHHuHxJuJLHEоK1i_H@LbiLHA1pKLzHu1@LLaHA8KLzHtKL1^H@La HHxJH5zHSH&H=^DxJ1^H=K`HwJyHTHH=)xJ1E^OM(LHHMME1E1MLALDž0*H=$H˘L0uhDžDž4MM)pHN4(fE1LL)Dž0H=n$XK10]H+QHHTDžDž~8HH=`0uDžLDžDžNH=GyJe_H7HDžLE1E1AHDž$HB?IM4?H)HL{L)HHMd*dL9#A}{ }L dIH*A$:LcIHtIIE8JHH`AŅH=HzJ_&H=1yJJ[H2H=yJ1A![H=u]HLI)HMt$M)H9u IxAALAsME1eHzJ_uiMuA{fJ{fJL^fuJL^AŅ-H=)yJ1UZDHJA"AAE$MB<($M0#(uEHܟxHןubHɟt2H轝H߉话HHHH HH,,ZH=1yJ YHH=yJLE1XH=3[~H=yJ1XHLH˜HӜ JKA{fJuJ{fJLEL\L羪uJ\AąuOH=yJ1IXDH>ElAH(@LH0AŅ1H wH u'JH=1A JH=_LH=J1IH>HlUH=J1I JL@reDHMdH3 %H[A\A]A^A_]f.pIHZH {HHHD p1ɇD%REI8H'1Ҿ9HH 6葇DElgQ9HcHH?HHHHЎAąu D EH聏DrEtHeaDHAƅIDž$H3H$HeDE = HE1 AEp Dž(5z HAą  Eu u A H=\1yJGHH" H=8IHS1H)d$EAGfDIHWD5E11H==yH者H; HƊ1ɾxHHPHwJH=FLAH H=;{J1gFfHߺI8N1Ҿ9HH ]踄H=IhJ1FH56N@LHߺ@̊H߉AϊtDH迊 $'MDf)@)P)`)p)E)E)E)EdAcDHHHHHH @HH @tE111H@蓉HAHE_cHHL@ocIHHH@!K@'L#L H薈1H0IHHEL0<DH= yJ1AgDH= 11Ҿ KNDH=a yJ1A/DH=H 11Ҿ zKH=nF fH3 H@H @L_bAŋ   EAD!DL[H=11Ҿ DHт@H=J1HL5;=s]t7 pIL'{H HLHHD =1u5(AH8@LL} 1L{ wLHHЩ uH='J1E16H=k8fD JL8L8H>L>H]dH3% H[A\A]A^A_]@H}uL}H=8zJ1 6H}tH}J11ɾL/=Hߺ@LIDQq lsJ LKJL{EMMuEd A u LA: NfDA.A/A\AD AHHHE A A:> zHJttHAHH‰ y@DE'H=I{J1u4I8H^x1Ҿ9LH mr*L?ۇJL4J LJLzLyH=J13LzH@1E1Lc HHLIAэz1A?DD(H1J @wJ@D(L@LHHH/H1/IH>LAH(HqH(GJHH11fHDAm/HH =H H(HpH(GJHH1O1A5D;(JH4f7fH=)hJ10H5N+JH3LH1LHLHwLp/sJH߅H8HdHHt11ALHhKH= Hx1HEHDpHxHpHHHHHdH1ɺNHEH7HH]HHtH= HE6E]E H=HtO1HHHHHt"H=F&L HOH=(J1THXHt H=y4$H=Yti=E"E#d"hf"l"~H=HcDHHtH=H;E!L0ASDH8 HXPH=[A]`tHH=bGc!HH=G1H(HLLARHHPSH= &H KXH("H HHH( HH'H=1LeE!H==HtO1HHHHH9 H=]FIHH=վJ1HXHt H=i43!$H= !l!==!L0WDH8 HXPH=AXAY`tHH=EHH=e1HWHHH}tH=6HU0FHH}tH=HUPFH,H HAJq0J11s@HH=HJ1H=11Ҿ H+H=H0HH=pH Hxq0J11AAJ>IHH=J1H=11Ҿ 7HLH=HGd1HDH`HHH=HHtH=HPGH=Ht$DH1H谺H8t0DHhHH8H=3vgH=Yt=WH=FFH@t-AwH@H=FL%HPH6 JHH111H?HHH=H=b@F@FH=K IH=:HT!F/H=IFH= `IFH=0IFH=IFH=H I H=HTEH~pF5H=}HE?HM1Ҿ6H=bpF5H=T?HM1Ҿ6H==HHHH=NI8HH=ÅtH= EtH=E~7=7A0Fu=_AF0FLD0tt H}VE1ɿdNHuDHUP5PAT1H5H=H0 D1a(",./薗Hf.rH8fDO 1 LHHH}Oh 2H@@dWuH0?ҖH.fD*? 謖HX$e"| 聖HD9=~v?U W@uJ&  HPH|hADDO;w ! ̕HT(5GA3 2 f G  :]HDDžnEH=¾uJ1YIHLY o Q ܔH$D DžEH=5¾L1_f.k }e耔H@7GA 'f`?AADžHlHHnfDrmp  H=D==~=}FDžtuK@ED=fD}v1Hy`Lzu[Džd@=DY=A& #?0wf{DD==FH舒;`@ LHD- DDž0fDž4iDž,YAAGDž(1fAADž$fAADž fDžAADžfDžyDžiDžYDžIDž9AA'DžfH=!K1MHDžHDžXfDžH} J.H} JHEHEDž AyDž\@rI9ˏH'賏HDžMfD苏DžHMD:[H(Ff+H8H赔HHtHH>HH=PJ1|H} J}蘎  JHHEHDH}# JFHEDžCHl+HcfD HS]8LH ?+9AADžHf@苍HsAHDLzD#Hx H@guJHVHH>ьH=RuJH1{fD諌HE11jAdNpdNHjdNhxdNAH yDžfD[HJCHZRy HgQfE<@HX"D 'M1ĒHDžHDž_fH} JE&H} JHE HE1HUH/kHH=}L1@H} JEH} JHE{HE莊HUHuHY/HH=L1fKH3HHLH_HGӉH/Iw@裉H苉Hh*[HCH+HEfGDžoHWH+MG8ˈH'賈H0Z苈HpsH[Hdֲ+AHDLwHP_IH=buJ1=St ut JJ‰Ѕt J'LADH} JH} JHEHEDžkH=K1HHKeLVLHx1A0LDH9'HH!Hx@A JHpu"HHHt%H11A3JH`N/wH}>LHx1APLDH&HHHx@ALJHx!H8HNHWHDžHDž8HDžHDžHDžHDžHDžHDž8HDžHDž4LH=xfH=ׯ1Ic׾|@HHDžHDžvfJH=QH=HDž8HDž8HDžH=̤xvJH=NH߻HDž8HDž>=Ǯt =ʮtWHîH=HKH=;nH=/H)H=UHbtH=PuLH=HyH=ݣ7mJyHDžHDžHDžNHDžHDžHDž8HDžH=ѭ;M*/5H=KlH=ڋJ1TOHDžHDžHDž8HDžHDžHDžHDž8HDžHDžHDžEH=<*H=1ɺ!O1ɺ*9{11Ҿ,&hH=PI(,H=1Ic־{HH=hDH=T;M-H=KaH=J1H=1-H=HI1i-:H=PL$H=F?'H=`dN1Ҿ@ H=HF?&H=g`dN1Ҿ@^HXHAH,H=:H,H="H,H= H,H=0LLSHP@KH=e1H=RHP KH=3H=6 H=PL0H=H߻GHpHt%AAJ11q0JH!HQH= (L11H=11Ҿ 'H=1ɺv_bH=kPLH=ZHH߻H=xL1`H=@F:+H=sHY@F +JH=DL1H=ԞL1tH=L1H=vJ1H=2vJSlH=ۨ1ɾ~GHl@KHH=8khH=1ɾ}HxhKHH=!dH=G1ɾ4H!dKHH=JH=A%11Ҿ,^H=ҧPI8#H=D#H=eH=1ɺ!1ɺ*HdH=Y1ɺv`UHAVIAUIATISHdH%HE1(HH1LdHHH1ɺHHMLG%LM"LHHv"L~(LHEv"xHMк AW(HMdH3 %LH[A\A]A^]@HHE1LIHhH$fH=E1!H H=qyJ1Hc=u"H=SMuLE1J[H=,WJH1Uff.UHAWE1AVE1AUE1ATISHx dH%HE1LߺDHMdH3 %H8[A\A]A^A_]fknIcyR1ty]H}rH1Ƀ 11HHEbLEHHL HBHEMt'LQH KLH*}EEuE1E1UH}wMIHEMHHLjMHE:ELEMfH}HuLLjMLE;LEMH}Eăk=HuLLELEE1H}eH}lH}H('H@;H}2HPVH}ӑJH|+@ BMi7|"$lwA3%JStAb%Jvt5AJJLE%J wZaHUHG1@6 g FAf====$'ADX`Hw|S$LA3%JStAb%Jvt5AJJLE3%J=A =DF蟣=e=uH_H=F_HHH=_HU&HFgJf=`_HUf.7HHtyHh HHHh<HPHHHHEH`HP HPH`HDžP^HHu;^H@f.=u^Hd@W"dH0FfD7|y5p$ A3%JStAb%Jvt5AJJLEJ!]HfDD⿃DDfDu+AπfUu(E1xDDD^fDOAHDž"J8u6]Hf.]HfDADADDžxDž|"Dž|5Dž|$Dž|S\Ho|tNtI$| A3%JStAb%Jvt5AJJLE$JDž|A@[H Hp[fDA ɤf.[Hos[1ҾHH(HK[H/HPtkHH Hh"HHHhH`9HPH`HDžHZHPfA|tVvtQ$7~ A$Jt"A%JJLEb%JH8H=zHL13Dž|v!AZH`A_H/H@tH@Hu{NH0HusL|@HPtHHHHHhHHHho9H`D HPHHH`HHEH5H11HUyaHDžHHDžP|ȃ AǀtEuE|HHt11HUAJ H ƒ|" A|"8 |SHDž RHDž0E1HDž8UHrSH@HP DEHXHLHEH E= =U  H@HuH Ht.H}H"JHPHEHr UHwHPH |$|TEA|S E1DXL8HhDbH`DIHHILA\#J1ɺ1HIH L(HM1HߋuA"J%IH HMH}EHL#Hx LA边LE1HhwD9=|SL8EDX E1H}H E |$Z HMHuELLP H=(v#J1TH}HuDHHIHtJuJHH E1DLAHHL蘵A9|H;L1E11J HhHfDHhHfD˹H`HfD諹H`HfDHhH `H@|ty|"u|u E' H11HUHDž`AHDžh6DEXAǀGIH=stL葹HDž`HDžhH}趸IH HaHH8H@HDP#HL蓴HH;HAQ"J1ɺ1wIHuHDž0I1۹HDž8E1HDžPHDž@H=s||HPH \KH=Qs1肵HDž`HDžhHDž`H=s J1IH@HhhH=r0[K8H 1ɺ1AQ"JuH0HHPHDž HMuA"J1L(HPH8HE11E1HDžPHDž@HhH=5r[K1atH=rZK;^DP@HH911HUAJH=qbE11E1HDž0HDž8HDžPHDž@AJ5SA3%JJLEyHPHDž0HHHPHPHDž0|}f苵HhHhA$Jn"A%JJLEWA$J"A%JJLEA$J"A%JJLEA$J"A%JJLEA$J"A%JJLEEAEEDŒLXHUH@H IDHEE1HlHHtHHPH¾$J1HHtHHPH¾$J1ܱHHtHHPH¾$J1賱E=)=mH@HuDHP11E1E11E1HDžPH8H=opL1,?LxADHHaIH?GH踽/HpL謽E11E1H`HHEHDž oM1۹E1HDž0HDž8HDžPHDž@yH=nL1,E11HDžPE1IH@11Hu+H=m1E1E1BHDž HDž8HDžPHDž@H@HUHuHJH=OmQLL8E1E1L8HE1E1AE%JQ1E1n|5mHHP1E1n1zHPH0EH8jsH=l8L1E1̮H=lL11E1誮A@}E11RH@A@LXHUPEY^HEHJA1H}ރH}HH}身9jAE%JAE%JBAE%JAE%JH\KKAE%JHPtH AHDž HP'`LH=Zk11E1膭|vHuDZH@HPHhH@H HPCHH#J11H=jE1 ;E11E1)HEAH@DHtHE#JEEAHE11E1H=Jj"JxH=/jJ1E1XHDž0AHDž QH@HuDHPHUHPfU]GH]BÐUHAUATAS1HHLhu/BJtHL4t٫AE9H[A\A]]fUHATS1HsdH%HE1HHELА u3JHuL)H}ZHEt<E9HMdH3 %u H[A\]ffDUHATS1H=sdH%HE1HHELժu7NHuL|~XH}\HEtE9HMdH3 %uH[A\]褩@UHAUATS1H{rdH%HE1HLЈLu,CfDHULLHENtҩE9HMdH3 %u H[A\A]]f.UHAWE1AVAUATSHHqLLLau!4LLLA@t*ED9HD[A\A]A^A_]DUHAWAVAUE1ATSH86qdH%HE1HHH8HHL(LHUHHMHUtSA3f.H}LELHUL~EoAtUDDD9HudH34%DuH8[A\A]A^A_]AsUHAWE1AVAUATSHFpdH%HE1HHHL L8L(HǧHUu.FDMLHUHL~OAtED9HMdH3 %DuH[A\A]A^A_]fDA蓦UfHAVE1AUATSH0dodH%HE1H)E)EHL0L@HHu1IDA HMLHL~LAtED9HudH34%DuFH0[A\A]A^]DH=cDL1AH=c@6菥ff.@UHAWAVAAUATS1H(L/IEMIŰHEIhHEIHEufy@nM|8n11MIH=V蒛fDHudH34%DuCHH[A\A]A^A_]þJ릾J럾[J똾J둾L늾&J냾@Jy~ff.UHAVAUATSL7IMftl1Au5H*aH{LI L~2ĘtAE9[A\A]A^]D[A\A]A^]UHATISH>HI<$H HҾH[A\H]UHATISH>nH覾I<$HZH蒾H[A\H]ÞUHAUIATHuAS1HdH%HE1HE&taHHtKHuE111AHt]DH~N11AA`NLHӸt/H}VHMdH3 %Hu H[A\A]]fH1Fff.@UALHSHHH=ST.JHE1yH=:T11Ҿ ĝȖH[]ff.fUILAHSHHH=Su((HAHHÐPI9HHH8tHx1H01yH0kHH0H,H|H0u Hc,HHH@HoHHAPH(HHwI=HH=OwJAH1HÐPʑH=ODž I9E f.H]dH3%H[A\A]A^A_]Du(1fDHÐPL9EtDž @H=NL1H=NI?Dž H=N1(L诐H=pNDž f.k8H=3NJ1_H= N賒Džf.Dž KAH=ML1H=MQGDž E7H։;Dž,gUHAWAVAUE1ATASHHHCPL{HLHEȋӏu8LDXHULLAH<~=AtAED9HD[A\A]A^A_]H=LJ1AߎH=L3)UHAWAVAUE1ATSHL7IFM~M`HEIFPHEuATDIFHHUALHuIFP WI<~<AtED9HD[A\A]A^A_]H=KJ1AH=KKAff.@UHAWAVAUE1ATASHHHCPL{HPLHEȋu8LD2VHULLAH<~=ύAtAED9HD[A\A]A^A_]H=J̔J1AH=JcYUHAWAVAUE1ATSHL7IFM~M@HEIFPHE#uATDIFHHUALHuIFP9UI<~<AťED9HD[A\A]A^A_]H=JJ1A'H=I{qff.@UHAWAVE1AUATSHL?dH%HE1MoMgI5u@XIGHMGXLHULHELTH<3~OAtߋED9HMdH3 %DuFH[A\A]A^A_]fDH=IJ1A'H=H{qʊf.UHAWAVAUE1ATSHL7IFM~MHEIFXHE3uATDIFHHUA$LHuIFXISI<~<At܊ED9HD[A\A]A^A_]H=HJ1A7H=G苌ff.@UHAWAVAUE1ATASHHHCPL{HØLsHEȋFu3GzRHULLA$H<1~=AtAED9HD[A\A]A^A_]H=1GJ1AWH=G請ff.@UHAWAVAUE1ATSHL7IFM~Mf`HEIFPHEfu葃H12HH<#t  H=>L1轀H=~>1C[ff. ff.ff.ff.UHAWAVAUATSH8dH%HE1HEdt4HMdH3 %H8[A\A]A^A_]fDHE gNAA@hNHE fNA@iNHE@gN1Ҿm0J1cIHL1ҾDL1IH}1҉IH}1ҾIuH}1҉HEdHEMMMH}H}蘜HHLc0JH茜E1HUe0JHLElLEHUg0JHOLEtlLJH7LEtTLh1JHE1t=H IHt-LHE,LEHE fDE11L裛H諛L胂L{LsH}jH}aLiHE@AAHE`kNAkNHE kNAlNHEkN @AHEiNAjNHE`iNAkNHEjN@1qLHuLLEALE}ff.UA1fE1E1ۺUMHAWAVHPE1AUE1ATE1S1HdH %HM1ɹ )0HfDL fD))HDžHDžHDž@DžHƅNDžHDžDžƅDžƅfDžfDHDž fDfDwGHHDƅHDžp DžxƅhDž8Dž`DžDžDžPDžHDž@HDžH@#]==X@{"   uS=6MuHH=8(Lx {D h{EHJH=81E11zH=8-}DžDžHDžHDžPDžx*@=I?=L=N3M=ODȈ~" qGE1ApRM蓡HTHھ`GH˦HpHwD9DHwHI8RxSxAxL=pIGHn= ARM DL=qpI>IGIJHUpBƄ=P}J`NM9uAIf79`{HH=6yJ1yDžxf/UM5#yx3 yH=l6E11ۉxzDžDžHDžHDžPH= AJE1qzJH=@[zH=ot%J<`NJI5zL9-nwHt 6BHZ1H=`t*fDHu1 DžHH fHÖHHH,fD P@HH=2@1JEtHtw<{ZsfDI/f1HH2Ht2[ƅI 8AH=6<uHLHlfD1艏H 證H?JH:1轿H 葇lH\JHL(L=i8ExCxIGHnvIG JʗJBƄ=PAHi*w JL5iJ`NҗJBƄ5PIFH`iv JڗJJ`NL5=iBƄ5PIFH)ivJ`N/IGHnBƄ=PLA,L5hJHIVHh hvJ`NH HDž HHHH HԾH߅褍H ȇH :6BHApRM1貀pG踘IKLGH`HYDJxS@xA6x,L5YIFH=IF3 JJBƄ5HY:u3 JJJNL5lYBƄ5IFHXYuJNL n9 L;nHR'xSutxAunxuhL=XIGH=ARM fDL=XI>IG' IJHXBƄ=_tJNM9uU$.JH8m0JHJHJHJH>JHJH JHmJHPSuxMux2u x5L5vWIVHDH^WJ@ HBƄ5rJNfDH=!,`L1E1Jnl4BL}sHHHRHHM)HVL5dE1H0ARMI4$HuIITMuE1Bd{eu {su{uAAfD:H޿JH޿ .JDD=H޿\JsH޿eJau+{eu%{su{uƅCAfD H޿JuƅHAfFH޿J7H޿JH޿JH޿JJHu"{mu{2u{DDDD H޿JDDDDMtOE1DfIM9 J<`NHruEƅhAB=PH0Ht_E1DD(MIIM9u JEtHI>HI>@{h{a{ƅ4Af6H޿JYEWHHپJH=1E11]AD$AƄ0DXDD(AfJ{A OMIIPM I7HduAGAƄ{-APMIIRMI7H\duAGAƄ{JHuJHƄA{aJ HvjJ HksJ HE|J H=J HƄA{ $JH+JHG3JH!;JHCJHKJHaSJ HƄAfoDžAf)ƅADžfDžAƅfoGAHH )AffƄA41H=L11IE1iUH=*11Ҿ \U5M1rGH5)r1@螢D5HH=cJ1TH=(WU2H1A.JHD=TOJBJ@H H=4EHDYTIcffHO*^@*YO; lTxLDH=HIE1SH=11Ҿ [#TN51QqGH芾5(q1@ D5HrH=cJ1?SH=US3H1A.JDcSOJBJ@H H=EHDRIcffH*^@*YO6-;DRxLDH=EHrIE1=RH=11Ҿ YR跟5!1oGH5o1@rD5{HH=|cJ1QH=iSQ4H1A.JDQOJBJ@H wH=EHD-QIcffH#*^@*Y@O;D ?QxLDH=EHIE1PH=g11Ҿ WP 51#npGH\5fm1@۝D5HTH= cJ1PH= eR[P6H1A.J56POJ@H H=u BJHDOIcffH*^@*YŠO ;=OxLDHiH= IE1OH= 11Ҿ ^VbO荜51l`GHɹ5ӫgl1@HD5QHѪH=R cJ1~NH=? PN7H\1A.JD=NOJBJ@H eH= EHDNIcffH*^@*YOul; NxLDH=\ HөIE1~MH=? 11Ҿ TM5b1jPGH45>j1@賚D5HDH= cJ1LH= =O3M8Hǩ1A.J]D MOJBJ@H بH=I EHDnLIcffHd*^@*YO;LLDH= HNۋxIE1KH= 11Ҿ 4S8Lc5ͨ1fi@GH蟶5=i1@D5'HH=( cJ1TKH= MK5H21A.JD xKOJBJ@H +H=EHDJIcffHϧ*^@*YpOKB;DJxLDH=1EHIE1RJH=11Ҿ QJ̗561g0GH5g1@臗D5HH=cJ1IH=~LJE>:HJ6HH;tkHL`IIHÐPI92@LMxiJ誱HHu I}IŐP莕M9uHH`E1HH0H(LxAECJHjHHHjHDžUHHHfooHP HHƅD9DžfDžH)H fDžƅ'ƅƅhjƅ9IƅJ1H Y&1raH [}H5dژJH<LH=1E11E21'11H=E11JGDžDžHDžHDžPQƅ' 11y1VJHH=:J1fDiD@HH=L1>DAAd11Hc`iJE1IH8IAFL@HP fDILE3H=EEH=A11Ҿ J&D#@D濎JC1eID$L;PuE1LC<6 JDHxHLpLL@HxLDJH LJHt+tLL1H=^B맋LřJ1Zd֙JLBڙJLUߙJL%JL"JL'JL#JL9JLJL` JLJL^LL1H=*A=DLpHxL@IFL;P#I1 LdNHƅtHƄuI\$HuHHttHHDž Mt$YNH LICEIEUH L9E8IFI~0FI~hFIFM9uH0JLd,JH8N,LI>I{FM9uHLcFHWFHKFH?FI>I,FI FM9uL@@I>IFL9uH;EH{EH{EH{EH{ HtwHtHEH{ xEH{(HtwHtHEH{(TEH{0E1LPA*H= tzI>II`EIpTEIHEJIP*JI*JI@*L9=wE1H=btKK DK(DK0DJKHIn*L9=wH{8JHÐPIŐPD*JH.*HPHP;E11ku'L/.J1I= (Z f(ٺJ%](Lf(^^f(=I/.J'L1'I'AN%]X(LAj]^Au IUf(^f(H/.J(L1H='wKvN NNf(f(L(L5\=\\^^f(^f(:HH;/.J()L1H&KvN NNUf(f(L(L5N\=F\9\^^f(^f(GH @ysosDstSDTshJL%s~'XJH=1F%ZJDH=L%HDžPH=h'DžxDžAdDžHHcPDMcLp)H(LiPH0HcHP~PflM)P$JLIƐPLC$JLI/1JH(IIHfoPHIxIpA?JIMJI [JIIM9;H=J1#HDžP1 LdNHTƅtHƄuI\$HuHHttHHDž M|$ 1H LH8%L8IAH L98I~1 LHƅdN„.HƄu1 LdNH4~ƅtHƄuI\$HuHHttHHDž Mt$/ H LI$AH L9:HD=w} LHƅdNAEHƄuH ttH1 LHƅdNtHƄu H؀ HuH HttHnIcX@O@OH ttH1 LHƅAǹdNEtHƄuH ttH1 LHƅAǹdNEtHƄu Iހ HuIA HttAIHm1 LHXƅdNEtHAD8ƄEuAL HuH HttLjmXZRmD1 LdNH{ƅtHƄuI\$HuHHttHHDž Mt$,H L I!A?HƅH L98H1 LdNHD=4zƅAE HƄu 1 LdNHyƅtHƄuI\$HuHHttHHDž Mt$+H LIg AIH L98I~D=.y1 LHƅdNAEHƄu JL1,L *LXkt㋅ ƒu ̅l ,~H=PL19`ufD1 LdNHOxƅtHƄuI\$HuHHttHHDž Mt$*H LIEIEH L98I1 LdNHD{wƅAEtHƄuHD B MtEtDKHM1 LHƅAdNEtHƄuB IuIEB MtEtENAIMHL(D0L8hL8 LD0L(IcHHX`O`O1EHƅdNtBƄHDEuB LuHItEtL;hHHXhOhO71 LdNHuƅtHƄuI\$HuHHttHHDž M|$'H LH8JL8IA0}H L9m8dIZ u1 LHƅdN„t7HƄu"H=(L1 fDH ttH1 LHƅdNtHƄu H؀ HuH HttHffIcXOOdH ttH1 LHƅAǹdNEtHƄuH ttH1 LHƅAǹdNEtHƄu Iހ HuIA HttAIHL8eeL8 LIcHHXOO1HƅdNEtHAD8ƄEuAL HuH HttLdHHXOO@ 1A.JN= =LHsxH=:IED1HrZH=11Ҿ c5>s13@pGH5s31@cD%EOJBJ@H (rH=҉HDIcffHr*^@* YŐO!;>H]r@HLLcLHcHtm~i@vH4H=LH1HMqH=cJ1H=&@H=x:J1HttH1 LdNHƅAEtHƄu Iހ HuIA HttAIHH8 bH8 LHcHHX O O1HƅdNEtHEBƄD8EuA6L5HuH05HttL{aHHX(O(OwH= ʾ J1JDLH`LLMtHÐPI9+ @LMdiJm{HHu{ I}IŐPQ_M9uJLBMIĐPL9 )Hھ LMH<eNzI$Hu I>IƐP^L9u1HHoHLL`LI`M ؙAՅHc.J xH=HeN8LHDHnD1H=n11Ҿ '_5n1*/DžDžHDžEZDž@HE1E1HsAHL @pGHH ]H=wJ1H=9/EDž0HHHfLE11)@)P)`)p))))fI}tdI}1H\HI}HH\HcHHHH @A9DLIŐPA9AE11A|$1H@!THE1D09u !@HAAHÐPE9H;tH{1H[HH{HH[HuHcHHH@HsHsAPIH߹@pGHh[X*wJ1AAHH=rAHÐPH=YE9D0Lu@AHÐPE9Dž0Ep56k+10[@Lc%HcOD-WHcؾBJOJ0@EH eNH=HD Hjff*@^0H[B*IDYŀO ;HH;HÐPYH9uH=L1 H=qg Dž08@H=J1 H=+! 5ia*1JZHc3HeNH=\cJ1 H=I DAAH=L1A H= Dž0EnD05iE<DHHL`I LuA@jHhLI LW At EA9|D@5vh )10XLc%ID(L1H= H=t j DH=:J1 HL)H=LH1 HhDž@AH=fQ'JHXH`H ifH޺1JHH1@H1H@fEJHHfH*`LMooHJH)@)PH`XooHHhxH)ooH))HHHھ>JH-HHHYHHH`IL,H-I$H"H@H- IĐPM9u1A.J;DI HeLDxH=EDH eIED1H=h11Ҿ D V5e1#&`GH\s5feA%1@U@5D EH;HÐP,I9uH,HDžHl 1A.Jz==+iLHdxH=fIED1HcH=G11Ҿ U5jd1%@pGHIƐPOL9u酺J1K1A.JDVOJBJ@H _H=EHDH_ff*^@B* YBO2); DxLH\_H=EۉIEDH!_12H=11Ҿ } O5_1 ]GHl5^1@gOLc%pH^H=qcJ1H=^(1fHcL xH=HeN.JHEH:^D1%H=11Ҿ ptN5 ^1@pGHk5]y1@ZNLc%cLc<  BJJ eN@H=GL0OJHDcHd]ff*^@L0B* K@IDYŀO;H ]@HLLeNLHjNHt8~4@MHH=wLH1\H=\:J1DJeNH=<cJ1hH=)'IHHZ$DDžEt@C0HHH[{=tH=[XM-Pv-#-5mGAgGLELHH`)HAHHIHA0HHH01 L.JDxH=DHDH+[DHZ1H=һ11Ҿ \D_KLfD-D= E=rItV1ɺ I,JIv%t 1ɺjI+IIN 11AAN=I8t(1A dNHH\3IHYI6DHHH2II6HH2IIN(H2IHHIH2HE1E111H[2I1-IƐPM9\`HIHF2Au0E1ɅAHE111H2I1[IOJJLcL_IIF HS1`GHa5S1C5ڿmbHHT`EH1LH@: €t5[ڿOhbHH[H=:P!L1fMH1E1HKMKMH H ?HHAELH1ID`ID$HID$PI|`HP+CzIL$IT$PA$It$I|`;+IĐPM9uApɞJKJHKM2Y5|L1 GLLKZ5ULHc 1I<зHD ŕJH=ʬHEɋKMLHDfA*M^HHOH1[IܘMIĘH()IL$IT$PA$It$IĘ)IĐPM9uH؋pJKJHKMW5%K1 ~GLLX5JHc 1Io;yHD+֕JH=sHEҋKM8LHD5fA*M^HHOH1IID$HID$XIH6(ȵIL$IT$XA$It$I(IĐPM9vH؋pJKJHKMvV5I1Y }GLLW5IHc, 1I :HDJH=HEۋKMhLHD&дfA*M^HHOH1IID$HHIH&aIL$HIt$MD$XI.'IĐP)M9sH؋pJKJHKMU5XH1|GH*V54HHc18HD-dJH=HE틈KMLHDnf*^HHOHH1-H€tHRH<ŨLMUgIHtGLL1I`IEHIEPI`Ht .%H=+L1H=2(H=*L1H=v SƄHL)E1E111Ҿ$.JH9nHHKMEHHNj8HDPHHE1 H߅A(H,HDž@H1UH CHȀtHH@H<ŨLMveIHH@H<ŨLMSeIHH1L IHH#LL"~1HL#eHHH=NL1m IH.H#LLf" 1H LM# HHL/# HH L# HH9  HH5 LHHÐPLHHHL(rL9BHkpJJLMZP5C1=_GHvQ5CHc13HھMJH=Hk=LMhLHDf*H^ՀOHЉI¸1H)HHH  H fDDBIMIUPAIuI@!QIŐPM9peJ3%JKMN5CB1|GHP5BHc12Hڋ=P J KMLH=HDD-]fL*^LH`OL1- KPIPHreIOA$IWPIwIP8IǐPD-ƬM9upeJE%JBKMM5@1 {GHN5@Lcm1N1XLD JH=RE KMLHDmfA*^HHhOHL`HӫH8L`P1MmHDž AB=tHD=JmL+z&HLÈHÐPUHHDž>LHDžkL9p\JJHLKME581_GHF58HcV17)AHھJH=BH=LKMLHDV f*H^@OHȉH0HHH)H1HH9r}@1ItCHoH5H71c[R;H7H=`74xC571 GHVE5`71'5עڿQb}!LH=ʗ1H=O?D+HrHHDHH)HHHH1H<HH9rJpJfHH)H1HH@pJE%JŬLMB5;61PyGH D56Lc1&L5HH=H@511TfGH?51Hc*1 "L^JH=Hk=HDHڋNMLNM#͜f*^HHOLIOIWPAIwIǐIǐPrM9uHkpE%JNMHNM\=501?eGHx>50HcIHx 1 LsJHxHk=HDH=ߐNMLNMfA*^HHOHH8H)H1HH=s!L1H=`=ƄH=5*J1aH="5LH PH=x+L1H=׏jZLMH=!L1H=)ƅ'B H.`XMDžHDžkG1@JH=;1,&Jf1ɺLJJHH LMooH9JH)@)PH` LMooHJHhxHZooHH))HooHH豪H蹪Hھ"JHyHHHHHH`IL$HLIEH۪H@HPĪIŐPM9uII}111IŐPM9uL1B9;H~,H=O,4x85k,1kGH=:5G,A1@@5DFE_H;HÐPL9uHgHDžHHpMDLIcƾXJI\Hc;R;pJHHc6HHHHp11HLHmLcJLHHIpE111LH>JLLH H߾HpHpHZE1퉅h=LDx.JHDGHp1H=DCH=11Ҿ D5&*1ykE1ui{H`H H~H0) A%DEEA9KcH H߾A(H*(((HDž HDž(dNH`H0Dž8H~cL`dN H߾IDLhff'LhHHHB hJ1艿E15~(1`=DOJBJ`JH=HDhffC* A*^`YB0OIE9a=AH t!JE1CH=f$J1IE9H5J E1Hp1H=((JB0OH= 9JIzE9雞ʚJ6J1%j=uH=ćJ1J(!LJ!Lw LmJcH=kcJo8LH=K1<LH=81) L1m AA KMH !ߑHh1҃&1BH‰H9Ptွ&uL,`NHHfLHDž)@)P)`)p)HHg;4JLAt5JLAtJLuEAHA_~M1HHxzHxLHH`H HItH@LH`HHILHH-IH_1HMA#AGwJL11LLHHJλH͜JHHx賻HHH}HxHLLHZ:HHHHH(HH< 1H* A wJH LHx1HH  H JʺH LHxHHH H~8LL9 u(LHLLLy H=OLJ1xH=9HvƹoHPH)HH1HH H ōHJ1҃1BH‰H9tွuL,NHHxHDžfHDž)@)P)`)p)))H LHgweJLDE1tHH HI}H߉HHH1qH`HHYH`HB{EtH@H_H`H詝H豝HLHI膝HH胝HHHHH5\HH Mk1LHVFAH1A HHnH[/JH :IH/HA HHH f))|HHyHHHHHVH.M.1LHGH LHA H+H A LHHHx H`HH HH0H(HH8H LHH@H&LHxPHxL9.pJL+51sD]GHD+5LcE1&XLLL=JHDH=$~RsJLpfHkA*^NL*5&1HiGD*5Lc1y LLL=3 JHDH=w}西OE%JLpfHkA*^N)5y1H bGDN*5XHc1 LHL=JHDH=| f*^HʉHkHN=' A!J1|B1H4T$J1L 9wſ ;߃H=|L &L10H={Hs.LHH)HHHs,uHtuHH DHyHHDHH)HHH1HfDfH=A{L[J1j5H=&{LEJ1OH= {L.J14H=zL&L1H=zL%L1fHO+H=zL꾘%L1H=}zL0%L証s LP&L1H=Uz舼SH=DzL1E1$Lj5 L`%L1H=zJD蛖LE1I蝖LHHH`HnH=yL1E1#LH=yL1E1$LػHHL1JVAă`HHveJH H@ HeJL;迕$.JI H=yL1?H=y蓽JJ1ƒ;myJH1H-JH1H H !=&LJ1EH=!xL꾠$L1JJHH=wLh$L1HH`HHLHH HLH8HxLH(HHHĺHPHL9pJL#51DP^GHDN$5XLc1LLL=ĖJHDH=v JLpfHkA*^N"51eHP`GD#5Lc>1LLL=ٸ֖JHDH=vK'JLpfHkA*^NE"51H@aGD"5Hc1r8LHL=,JHDH=pu螷 Hf*^HʉHkHN;H=)uLۜJ1RH=uL@$L17JL~DžH=tL$L1H=t#L1gH=tL꾸#L1ɶLHIU1ɾ4JHA4JH޹ H@HkH=BtL1nH=/t¸&HHL1JÃHuyLHveJAL@L H@A$.JDH#LH=s1ɵH=sg~ H=isL1蕵H=VsߵYH=;sJ1g~4x#L{H=sH#L1?} #LS"LI"L?eJ5"L+x"L!P"L"LH=rH=rL1ʴH=rH=pr¾P L1蚴( L蛨Zx L1芨0JÈUXMHAWE1AVE1AUAߢJATE1S1HhdH%HE1HEHEEOEHEHDžpeJHEJHEHDžxHEHED\t_ uP1ҾHPHE[u1V11HULM)HuLEcA?-HMuu AuE1LEA.JLHH)-IHH}t%L}LnILHzUHL/HUHLzLIHH}wIHLHǾJ16L纼E1JE1>t@  b5OHE$@HUH=oJ1蹱AE11E1E1H}L跴L?LH蟲H}&H}J胳DHMdH3 %Hh[A\A]A^A_]fD|mVGQf..fDE@A D NIMHUH4DMHEf.MHEfMIXME1E11TE1E1{MIkkMHpWSMHx?Hx1IH4HUHpHʳHHDIHH}w5IH2LIHËEuVEHLE1HJH=m1PAE1E1H=m J.pHLH=l\J1낾JLHYH=lGJ11AE1̮H=l HUH=xlE11۾)JAE1蘮H=YlL纸JE1蒰AA1H=ljJ1BH=l薰Deffff.UHAWIAVIHAUMATISHHH1dH%HE1L~HHHDž)Q  MHcLƄMLMHMHHIHLLLbJLLE5HHH]dH3%LHe[A\A]A^A_]ÐHH=jL1AUML/L辬}XZ~H=wjHJ1蜬LE1H=Ij/L1u[+J/L7UHAWE1AVIHAUMATISHXHHHdH%HE1L~HDž)~ ~kHc؋EƄHMMLHH1IHHHHHH5}'H]dH3%Lu}HX[A\A]A^A_]M$HL1H=hp0LDHML1H=h 0L7H=hH0L1ժ\苪ff.UHAUATSHHtSII1ۀIu4rID$HxhH:ItHpL褱tID$Hx9|ûH[A\A]]fHpLdtڃID$Hx迧9}ID$HxH:IuUHAVAUATISHGHxçIH8ItIu ILy [A\A]A^]fIT$1Hz~JJH=UgHHI1I H=5g1JH[Hu[A\A]A^]@ID$1HxJJH=fHHI1I H=f1JHHuUZMHAWAAVE1AUE1ATE1S1HdH%HE1HEHEBDHDžhHpHDžPHDžXHDž`HDžx@P  uHpJ11H=eHDžpEH}qJH}rJ۩H=|eA Hp轪H5Hx9 DHMdH3 %He[A\A]A^A_]@9DHPOkJL@JH@蔋Hht MA\ AGHDž(HL t LD HMHULHo Hh3 HDžpE_ Hh1HHH@AE1DLDPHxf.HCHxAϣA9.HCDHxH:IuDPEy"H`HtHpEDDPHCEHxA~DE1褣JJH={cHHI1襥DK H=]cD1JI肥IuHCEHx4@ tpzBHX==:HDžpA1ED)#BHB1ҾHHxhAHhOZMHEH}qJ1E1荦H}rJzHDžpf.{AIkAH`A9 AfDAI@AI{AH=aD4L1謣H}qJ蹥H}rJ覥EHDžp1E1뜋L H@HHH@H(XH=`0L11HDžp HDžp1DLEPi EA HDž0A L@DžLPEPE1 D8L(KtfH=A`L⾄J1jULH2H߉@@@A M !IMeMcMPuLA~iULHxKvA2ApAuHCHxuH=V_LJH@1xH@Dž8HR=@AAuH=_L2L1*LA AuH0fHEELMHL@HHHHELAVHPHpxA[HXH JLH@ JJHEJH@HEHH}HEHHH}H}H}HXHtJH蒤HEH{¤J8ƔH{IHEID$0LI$HEID$HEID$HEID$HEID$ HEID$(蹤Dž8s|HCHx[H=<]L⾪JH@1^H@Dž8HV#HCΉ@Hx @IHH0H=WL3L1J1蠀6fDH/E ~r3HtH(7=Y=U "H8HH=A=Dw`2f./Hu`qfAdDES@ADDe0@SH;H#HxxHHH~HPfHNsH6`MN"H-Ht$DH=;4J1H}HHu1E1w HpH0H@HXH8HuWxu!HHt11HUHp1IHHpH=:J1}1- JLmHt46 JH萅HAHH8XH8H9LaoHpH9{:tL!¸"xwx}H@xHHHPHXiD`"JH@EHEEH`规HhH1HhEK HxHHDžpHPH XO HHH "JH4IH| 1HIH 1HHHX 1H߉UHXUHPHEHJ H}HՇHt>H}H H E1HHc H(tP辔H}H”H^ WLXE1PH(H_AXAY HtKTH}HhH RLX1ɾPHE1HY^& H`Ht H}نHuH HHt2H`1JH賽H HH LLE HxHA1rJPE[xJHhсHx%HpH1E@HhH=68L1E1yDD`E4HPtHXH@HrGIH& 1H1HDžpIM H0wHHtLH`H= 6zL跀Hp諀H裀LK`HhH=58L1E1w1D`E!H@tHH H@]H@"JTHEH 1H}Ey ðHxHN HHpH IH IHt!1HtLLHx1HpLE1GLH=4CyH}Z1S1L1EH=L`GH=h4xH=W4xH=F4JtvHPtHH&HPH HHXvrJ11HDžpHDžxJE1_H=3SxHEHXHDžpHhHhHE IH Hk HPHA TtHxHHhxAtIHxL0MHxHFH?LPL="HhHXHMHpHuLLLH H_1yIH+HLA}H}h1|E;HHxSJHhHvuHh ))MJHchHhHcuHHAHcHMHxHhLHHM:HMDLHM/HMHPHME1 HxrH} JuLxHMH=~EHEHH"JHxHEHp{HEHfHLIHKIH:HЄHLLHLLHLLLHLLLxHpMLLHd`HxH8HLQ=LLLK'H LLL> LLL8LLL2LLL,LLL&LLL LLLLLLpHuLIHXL H}yH=/8J10qHEH0w蚸HHELHH`H0wIHHLH`DJpHpHEHDžxH0w߷HHELBHH藋`%1LLL$11E1@LH}_xH=-J1oHEDž`E1LH`Dž`HpHxL1F1/L7*HHtIHPH"JwIHHHtRE1E1E1E11HLLdwL rJ11讐H=,a JnH(H=m,J1nH}{HE1LE1E1vxE1pHXHu贄HUHHt=JE1E1LH`$Dž`H=+JE1E1mHH=+˨J1m0HpHJA61`HPr%HpH1E1E1HDžp"E1IE1E1>HH=+J1@mH=*a J*mE1E1HDžp IHDž`11E11E1LHME1H=*J1lH=}*oHMHH;E=H=N*ZJ1zl1Sw11H H="*3J1Nl1iE11ZHDžx1E1EHDžx1E1HDžP%fJ虇HhH51E1HDžxE1HDžPfDUHAWAVAUAHATISHQL7EtBuAuL}ktHD[A\A]A^A_]@+tfIHt7[LIiH=(L1H脫H=(J1kHcLILAgJMHJEH=(HDо;L1 jSE$@gM@L|A'ff.fUHAWI1AVAUATSH8H}LLeHUHM1LEA"JDM轣IH1Mu-7LhLHI(QLg9,IHLe1L貿HMLLLAąHEHt HL葿HEHt HL荿LUMøl/JLDH=@'L1E1侀&HH͎n&H@&w&H@HE11HAHHWHxHWHt@ufDH%1HSHH WfDHHHHB fH AFAfD{HoADXi*A}@3H'AFAfDADHLHH:@LHf.ADHsH g`qMDžHDžHDžHDžHDžHDžpHDžhHDž`HDžHDžxHDžHDžfDH8HJHHKHmHH~@VH=1HGHHH;@ lfDAFAfDH0H7 AHADLADAFHA~yCHH'@[CHHACHHW}H=(AL1@rH=`AL1@ZH=} J@DDžH=XAL1@H@LH=/H1]@H=lJ1E@{HALH=H1@HDžh JH3KHpHHDžHDžHDžHDžHDžHDžHDžH)HDžhDHDž`HDžxzhBLH=1@?HDžHDžHDžHDžHDžpHDžhHDžHDžHDžHDž`HDžHDžHDžHDžHDžHDžpHDžhHDžHDž|H=&AL1R>H=AL1:>H8HDžH=8DL1 >H=BL1= H@HH0@Lp@LHDH=1=HDžHDžHDžHDžHDžutH=,0EL1X=HdH A0 JHvHHDžHpHxHH `wHDžH`HHHxHH H8H=UpDLHDžHDžHDžHDžHDžDZyH=HFL1;pHDžHDžpH=NFL1z;HDžHDžHDžHDž`JeJH,H8HuHDž8eJeH=BL1;u` uBH tH=CL1:H=CL1:H=qhCL1:H=\ CL1:H=GDLu:HDžHDžHDžHDž[XwH=DL1:H@HHAHH菋zHDžHDžHDžHDžHDžHDžDHxwH膐~H腐`DA߉HHH67oNHރHVHuDDRH6/NL狝l6~ {L6Ht;LHLn?HH8LHqu[HH0HxHOHu(eHHu)HHDžEiEH0JDADHHLHEH D9D9D9D9D9D9D9OD98D9!D9D9 D9D9D9D9:D9LD96D9D9AD9bD9LK5*+JHH;/HDžH=* GL1V6HDžHDžRHLlnH=GL6pH8H=K5HDžH=xK5HDžp&LH1HL=HL?zH@LXH 1A! JH[sHHHH,>tpLL1H0HH^KHDž H=FL14HDžHDžH=J4HDžHDžHxHLLH1H0HJHDžHDžEUDLHAHHHH H =umHHEtSDžH=cJ3HH81׊H8苄qq=H= HL1L3^HHd={1x}HHxH87H8Ho/HJ12L̉HH]0H(*J7IHy1HLDž@HLHЍPLHcHL)H9'0H@,t@uHpH9t@H΃@Hc@0JHsHH1HL1HLHЍPLHcHL)H958H@,t@uHxH9tLHcI @HDžE1H8D0L 9H//HI$HL/FIHt JHP8t1LLm/t5H9@~HLH48uMu3IHuH8D0L 3LH8D0L @.trE11L1H L.RJH2SJLz2E1H(H1E1QJ70HDžH(GLH0HDžE1wH=1E1E13J/HDžNHDžHDžHnJ1/LH* I HLHKIHLH8HUHkLAEEHH1E1+JA:!/(AV +JH9BT5AE1I.8D96H߾J1LL(3HLH 6JH1H߾J1LL(oH=N7mJ1z.H=6#J1b.tL0LHLH5HH Tv oJH1.H$.JwLuHFmJbL_HDž8HlJH8KH8HMH81JH1-˭JH1-DžeD¾JH1k-DL JLHAƾJ1A-AWEJH1-c;VHI衄LA1DLIvJLH߉J1,DAE"JH1, Lm0JLJH8h1JLHDž8DJH1>,+H1DžDž8DžDž(KH=f=HHV1H&.}?HDžHDžHDžHDžELH=?EL1k+HxHtHHkAHHHMEHHt$HHP1H5EH=(kK1*HnDHDžHDžH8H=mFL*HDžHDžH=AJo*'XHhHhH0]H@HE11HAHH0H@$H=nJ)HDžHDžH:(HH0oH HDž@HDž1 H 1H8{,HHtCHB3 8cHH H@1,(HJ+H:-H@HDžHDžHH4H@.'eHH+@HHyJHOHH@HH H_-H HHH.srlAH@H_HAHHH@1HHHHH1H1.H@H=lFL'1L[HtkH¾4JH1t'LD9tZNoIE1!DLA'%4JHH15'L$D9L0ojJH)X~ILw%nJHH1LJ'1H*IHH0tu1L -IHtcL*LH~@Lf1JHi)JH1e&L&HHB@JH1C&L*HL~H¾Y+JH1&aL ~L~L~˾JH1%uJH1%GLH1% H=1&H!&H&UHSHH&Ht HH[]Ð1H5t6y}HH%HuH=n1H%HH[]H=n~f.UHAWAVAUATSHdH%HE1HQHH>IHH 1H8H5w1L$H H@{>CH<HcHHE1LH1HPoLL2LHAM<I)H1LLH1~HII)EuHKH(1HLL1(HAH~MH(H 0H5H81#H HHudH34%XH[A\A]A^A_]HE1LHH0E1LxHH/E1LHHE1LuHH/E1LUHc1HLLl0AAMef.K1HBLL)0lHII)_@H$/ALHH51"!UH.HSHHHH=dH%HE1CSH5HcHHCHHrH5JH81!HEdH3%H[]HuHyH%HUH5H81@!fDHuH|yHHUH50H81!rHSNHHSH5H81 >HHKH5jH81 HiH5H81 > fffff.Eff.UHAUIATSHHL&Mt0GLHe'u!CHSLHsH[A\A]]pxH[A\A]]UH= H5HI/]Hu ff.UHSHHDHtZH=K HHtt.H[]fDHE!HuHHH uoH1[]fDHH=IiH17yHH8!1@U@HAVAUATSH0dH%HE1HHcHHudH34%lH0[A\A]A^]fD\H5HI#IH=H&HHwH@HE?'I9rDI9tHH DJ uHEDJ tHHHEH DJ u:L.&H]HPHUA}IEHEHE8E/HUH5THMÅ"EȅH5LfD賺HHHf苺HHt 8HDHHGAH[Hc4@1#HE諠LH=Ig1H1v9HH]wH=xgHH11v@HELLm@LuLe3H=gHLL1LvffUHHATS Ht HHHtxH=t7[A\]L%HH5\1I<$I<$;H=uɺH5JH= HfHuL%rHH59I<$I<$[A\]f.UHAWAVAUATAS1HH=9H=AIMt<:tIAuuDAHLqsyUL%LH5Y1I<$I<$E157AHL-sxRAFM~rEDDH==-95H=&HD[A\A]A^A_]L-(LH51M~I}GI}AFuE1E1UHSHH=Ht-rt,H=[H5nHH[]HH5o1H;H;1ff.UHtTuAH=0sH5誶tH5HHH]@H=t&qH=H]KHHu1]ff.U\HAWAVAUIHH5ATSHdH%HE19Hy:HIE1 HHtHH6IǹH=TLuypIHDHHpLLAp{H5L=HUdH3%DH[A\A]A^A_] H=LAuH^HHuHE.LpH5mHL}I pIH,@HAH5`1H;hH;H5Nb1E1TLHAU\HAWAVAUIHH5ATSHdH%HE1iHy:HIE1HHtHHfIǹH=Luy$oIHDHHoLLA!o{H5LmHUdH3%DH[A\A]A^A_] H=LAuH^HHuHEC,LpH5HL}IPnIH,@HqH51H;H;H5`1E1LH1AH8VH?0uH?0tHv>0ufDH>0t:f.H(IH?0uH?0tIfUHAWEAVAUIATISHHHMkHMLH1IE1cmHt5HHckLHSmAąy,EugAH#HD[A\A]A^A_]L&mHI+mHCLDkL[#fHLE1lADUHAWAVAUATSHLn MHILE1[H IHt 1HlINjst1@HS1E1PH7L0DKH3WZYDZHHH+LIHMtL1Ҿ7HQL(WHLmSHeLH[A\A]A^A_]f.H"*u HHtz_uSHHuG%= =H_^=uH)H5>H81P!LskLVLH!fHh1HeH[A\A]A^A_]@H=t)HR]=oDHy^\@H ^L@H]<@UHAWAVAUIATS1HH}HjEIL 9@L6LpA<-<+EIIuHt~MfII7HtdL|uIGHMHH#}HtaI GHL9wH5L( EH[A\A]A^A_]fDEIE\IWHH!HUHff.ff.UHHAUMATISHH u-MLLiH[A\A]]fDHHt kit?HtHLgit+MuH[A\A]]fDLPi@1H[A\A]]t$Et׋EuL0ijDE'iDE܅1ff.Ht lfDlff.=tH f.lff.UHAUIATISHHuHLLHHtJ\HH[A\A]]@cHH[A\A]]DUHAVIAUIATISHHLLLChÅu[A\A]A^]D[[A\A]A^]UHAVAUIATISHdH%HE1HE1HgHULHHS~'HMdH3 %HH[A\A]A^]@LuM~O蚑L%LH5H1I<$ I<$MtLLH5ڷ1 H1DKL%LH5H1I<$o I<$MuH51X  U1HHAVAUATSHHtRHHI1_IHu.fL HpHxIHfAƅt$L 9A[DA\A]A^]HIL$H5 ZIT$H81 [DA\A]A^]f.HQLH5YE1H81r Ht+UHSHH HHH[]-fff.@Ht3UHSHHHH߹)[HcH]'DUHSHHHHPHXL`Lht#)p)M)U)])e)m)u)}dH%H81HHFHEH(H H@H;H0Dž Dž$0[H; @U|HAUIH5xATISHLHHtHH[A\A]]fD諎LLH=VXH1HH[A\A]]fDUHATIS,t9H@ttIA$,tDQ t1҄u[HA\]fDA$AL$IT$H0HDN tH HDN u[A\HD]H@1[A\H]ff.HtH _1DHt[UHHSHH3t/HHt$uHHH[]f1H[]1ff.fUHH=E H}t* ]UHATISHH5H uI$[A\]fDH5H 1u[I$A\]ff.@UHATISHH59HD uA$[A\]fDH5/H u[A$A\]H5 H 1uA$f.HHu@UHAWAVE1AUAATSHHHUaHEH}D9fH}DHI^DHHIat0}t<DH^HDLHauDLH`tH}A$D9{H}H5+EEH[A\A]A^A_]Ð1ff.fUHAVIAUIATSHHIMt LH L%H=t{1Mt,LHLFGHH5[A\A]A^] L1 HHI HH5 [L4A\H5A]A^]DH5^Ha s[A\A]A^]UHATISHHH50lHHLHH5Q([HA\]ff.U1HAWAVAUIH5SATISLHL t4H5ZL1HLH5_1[A\A]A^A_]@LHA_AŅ~DpH5IfDH5 L1_AE9tH5*AA9HHDHL1#E9H5L1 U1HAWAVIΉAUAHH5ATISHEAEE̅ M1fD9AH5mL1I};]|D9HcA#@AH5L1HFA9~hA9uH5L1DH5L1AL1H5ӮI9]2D9jHLH51[A\A]A^A_]f.1:fUHAWAAVMAUIATISH(uDM7UHHEHEH9MuȅMdE[Muut HeH[A\A]A^A_] UHH HHuLM1LE1HTZYuL%I<$MtLH5I<$ H1xf.HHHWMHuLMLE1HHE7TA[Z HLUuLME1LL׾TAYAZL-ſLH51I}I}1SHHHE1MtwLHSgL%[LH511I<$~I<$DHuLME1Hǹ1Ҿ>S_AXfD1ҾH SHH8qH1fHv(H(#ff.UHAWAVIAUIATISHHdH%HE1\IHHHAD=LIL1HnL5H5L HH1LIHHHAH5HMtMeE1HL DHMdH3 %H[A\A]A^A_]=9LLLrHDL%iI<$E1E1L%QH5j11I<$uL%1H52M1I<$WUHAWAVIAUIATISHdH%HE1LHLID9L؁HML1H٩H 1MLLHL} LLXy t LHX¸xSHMdH3 %H[A\A]A^A_]fDL- H5"1I}/I}1fL-LH1H5 I}H=HLW@L-LL1H5̨I}H=רkff.UHAVIAUATSHHtR1ɺWtJIMtULLE1HAL9t+L[DA\A]A^]cIHuE1[DA\A]A^]@A1ɃHWAŅtAM{fDUHAWIAVIAUIATSH(dH%HE1HH H5L>IMt 1MAEMt}HHLM1HlIHMtI1L~HLHMdH3 %H([A\A]A^A_]fDIHtXHH-uL=LH5II?LI?E1ZE1L=N@L=AH5_1I?hfDL=!LH5II?GDLHL=L=H5jI1I?kfDU1LH HSHHHUtju H[]H{LH HRTuHCHVH5?IHH(HP L@0H;1q/HCH%H5HHH(HP L@0H;1@H;H1[]ff.@UHAWAVIAUATISHH(dH%HE1LIAA,LHپIHHH1MoMHپHL1SMHپHmL17H5LIHIvHLH~qH5LHHAH0H5XH߅H!HD1H6HMdH3 %uwH([A\A]A^A_]L%I<$1@L%iH51I<$DHHL%:H1H5I<$]fDUHAWAVIAUIATISHdH%HE1LHLID9L؁HL1HHMLHH1MLHHɢ1_MLLHr1L<H1MLHQ LLUQy,t LLH1QLLLLQy\tPtKL-LL1H5סI}H=HLPHLPm@LLLLP¸HMdH3 %H[A\A]A^A_]L-H5*1I}7I}1f.L-LH1H5 I}H=HLO@L-LL1H5̠I}H=נyL-qLL1H5I}H=HLO,ff.HtKUHSHHHOH{RH5QHHߺS[H5z]7ff.@Ht(0IwH fHcHD1ff.UHAWIAVAUATSH(?/uUHMsIHIH5՞E1LIH3LuMAbMfIIAGAt<=uAA>I_GAFIVIA.H߉EA"HUuAUH}HAAZYDmfDBt0HrHLABIRE^@LuvHMH5BHHH81LE1H5LHeL[A\A]A^A_][vH\HMMHH5B1H;yE)+vH;H5BH1W vHMMH5CHHH81+uHMME1HHկH5@H81>HIH5=LLuLuuLELH5hAHHvH81ZuH5HHQH81IEL-,LuI}uHMI}IHMH5RB13VtHMH5@HHܮH81 -DUHAWAVAUIATSHHHHHdH%HE1HxHI1LHLLADžtex3LLD9u!HHHH9rHMtL9vL1HMdH3 %HH[A\A]A^A_]Ð11Ҿ Lo1ҾsLHYLAHHHGHHHHHG2r1cd@U HAUIHATH5SHHtO:HHE1HtHPHL-*AĺH5HVHD[A\A]]AUHAWAVAUATSHxdH%HE1HDžhHt\ILpHILPLItX#I+HLMjHHhMH ZYuL1HMdH3 %He[A\A]A^A_]ùH=LLDDMt>Lh1'LLHIx~L9|ոiHLH5=1H;H;5LHL[A\]DUHAWAVMAUAATISHHHMLMIEt>MtHULLLG1LuH[A\A]A^A_]@HDtLmAHH z HLHI~EHELELEDH)E{H]]8EHjHMMSHU1hHuEHE8jHEHEpAWxujP5jjAV=HpLHHh1H=HIHMdH3 %LuHe[A\A]A^A_]DE1ff.UHAUAATAH}SH8dH%HE1u=HEtH]Eu,HfHEdH3%u;H8[A\A]]>=H+ffH*H*^zf.ff.kff.H9H81=H9H8!=UHATISHcL<[A\]ff.fUHATISHcL<[A\]ff.fUHwJ]E‰HH8{LHć01E11n@UHwD]E‰HH8{6ff.18fUHAUATASHH=SHHdH%HE1uH=%HEuzH=#HH= H6HHHH5,HїE1H81H=HvHHAAtH=|7HlE HHt"H5߃HIHUdH3%LH[A\A]]HH4IH@H5HIH{H5eIfDH=hH HH8H5HHpHHaE1H81HH5HHH52HHHp;14HHHHH5HHHHHH5H81aH߾:HH:Ht H)H~'H5)1E1H51*PHH5)1pE1H=!H5;H UHAVIAUIATISHHtTHtOJH5IEHtLHI[A\A]A^]f.Hu[MtIEMt1DMuMt[A\IA]A^]Ð1HIEHu1f1HIEHuff.UHAUATHUISHHdH%HE1HH^HEHD11t/HEMtHtAHMdH3 %~H[A\A]]HHH5(H81L-yH5(I}H5L HEHuI}HH5(qHEo#UHAWAVAUATASHLmHU(HEHHH] H(HU0LL}8HHU@DHLH dH4%Hu1DI,HM 'HH HH HHH~HHH(tH(HHtHH8M I1E1Ht HH8AAAA~)`A A E1HAupL01H5ـLHPo0Lo@HE)p)UHPo0Lpo@HE]eHVL0jLLjHHL`H"AYAZIMDEHH DžHDžL(I L LLL L eHHDž(1IE1IL"1HHOЅHNHH<HHM1ۅHUdH3% He[A\A]A^A_]f.HSH(rH(HHHQL!0Lh!HtHIh!AŃwPH CHcHfDH t.L6-H HHHDž L(!SML,IH{LE1 @HtL,HHW1H(L,H(HHL HDž(H L,HHHHDžLX LHDHE1A:HDEDE1ECL1@H j H HHHuHH@LEHjDRHLuHlL L@HAJ@HL*HHH880H3L*1HHH8fLE"@LEHz DDL%a|L-H5k{I}(L%LI<$)I<$1)HH/+LHLjHILjLH5*AQL`)LH ILHzHDL-AH5!1I}gLL#LHMHLI}HLH5?p1HHtI}HH5nz1&I}H51I}+&1HyHDE1EL-_H5P 1I} L-AH5y1I}gLH%@Hr@HH(yH(HHHM1AH( HHH8HHiDHHHLDE1EL-6H5x1I}\HuMH>IH1E1fDMHHHDE1EL-H5wI}d@߁sI}H5&xH1)HH5m1sHI}1H5wZBDL-H5w1I}7fHHMHwHHH;H(HHRHHHHMHHvHsH(HHHhHfDME1DL LHI}H5Pl1$ H(|H(HHt HH8t?MtHI1E1HH1AHHHHuHHHHH8HWHHHH8MtHPI1E1HHP1AHMH1E1HMtIHIH}Mt` AHWIHOHe1AH4HU1AHHtWH>tHEHHHHOHW1Ht&HHH5 H811HsHUAIHATSHH dH%HE1MHHELDHt4H=sHthH=sHtvHHEE1LjDHjjPjjjHEH@HUdH3%He[A\]@HLH5H81HE111HLE!HEHuL%NI<$LEI<$HH5s1LaHEhUAHAUATISHHdH%HE1HHHEHDHt4H=rLtfH=}rLttHHEE1Ij1DLPjjjjjTHEH@HUdH3%u}He[A\A]]fHQHH5gH81uHE111L HEHuL-I}I}LHH5q1)HEtff.UHAWAVIAULATE1SH(dH%HE1HEHEzD9DLHHLh fL59}qLgHuH}IuH~LHtHH=p€uH p11HLAD9;1HMdH3 %uH([A\A]A^A_]fDUHAWAVAUATISHHHLS11ҾgHIHIL5]LILMtbLHtS11ҾYLHI?LLIMtLHtHH[A\A]A^A_]LH1F@UHAVAAUATASLH dH%HE1MHHEHDE1tcHHEE1jIDDjjjjjP5H@:LH5kHEHUdH3%u3He[A\A]A^]DHHLHM&$HMHI|fUHAWAVIAUATASLH(UHMdH%HE1MHHEHDE1trHL}HMUjAIDjLjjjAWjQH@H}tVOH5jLHEHMdH3 %ubHe[A\A]A^A_]HHLB#IIuHHMUE1jIDLjjjjjAWH@wؿUHAUIATISLH dH%HE1MHljHDHEj1jjIPjjHEZHEH@HtMtLH t!HEHMdH3 %uCHe[A\A]]L-9}I}I}LHH5g1PH}g1ff.E1UHAWIAVMAUIATISLH(Mt8H5zlLwH5UlL[LH`HE11j1LIjHATAWjjjHE%LUH@ALBEMIHH=HIH}LHt^LkHL=kMN蕼11HLH5wMHHH{H81H56hHMNM<$DuE1Lm ALDA9{DLpHHHAjHIH}LHtdHkLkHLOLE辻11HBHULEH5IHHzH81 H5]gLAP>Hf11HHULjH5@HHHzH81豼H5gH轾MtI<$bI$HeD[A\A]A^A_]H!zHH5E1H81BHHvLDIE/fDDuf.UHAWIAVIAUIATSH(HudH%HE1HEIMHHEHEfLHHU1AWLEM1LHhZYtjHuLQt=H}IAHEHuHMdH3 %Lu@He[A\A]A^A_]HxH5H81H}LE1轺ff.fUHAWAVAUATSH8HuHUdH%HE1HEH#HEII1HELدHHU1AWLMLLEITZYLeHE1&DL%HHt^ALʷA9|H}MHEMhHUdH3%Hu^He[A\A]A^A_]H1H}襺{ HHRH}膺@H11Kff.UH0BHATSHHH:AjMjLDE1R1jjjjH@uEuHe[A\]DH;EEHHe[A\]f.UIH fHATSHHH>AVHHjLDE11j1jjjj]H@uEuHe[A\]H;H5nEEHHe[A\]ff.UHATASHt?-Hu)u#ArbH[A\]@AD$<BHArzAw Aa1HHu8IAryH eL%uHH5d1I<$諷hfHY}8FHH f.[8$HJeHL%uH5c1I<$AI<$蘹[1A\]Ð H5DH߅H&eHD轿H8H dI"fI H5WH߅HHDmH{8hH IfH5ȹH߅HHDH+O8IH b H5`H= UHAVAUIATSuNrIH111LHHtML5H[A\A]A^]frRIHtjuE1H{HHuL5as1I>MtI>LH5c1v@a(CfDE1ff.UHAWIAVIAUATISHuzL-r1ҾIMIEHMHMHIMHtoH臻LHIHMu+HrH5 H8蝷HpHHuHH[A\A]A^A_]fDK1ҾLHH蓺H諺HH[]ÐH蓺HH[]fH5_HHDH5wHHDH5HHDb H5[H=UHAUIsATAHMS1HdH%HE1HETDLHHHEHHHp xHUHAH;t(L%lnLH5Z1I<$菰I<$E1HDHMdH3 %u:H[A\A]]fDL%nH5p^1I<$/DL%mf.U1HAUATLHISLHdH%HE1 t HHHu%HEdH3%HĨ[A\A]]@HH5]xLLHH HP1HHHHHtxHL 1A M9ύANHcHIHL PI9u1E11 H5}YH86 H5aYH1议ff.HcHWtUHATSHt!HIH=]Hu[A\]H1 ÅuHAlLH5WH81e[A\]ff.UHAWEAVIAUIATASHH5\HHQu1H[A\A]A^A_]f.H5]\L!tHtH=/\HL 1HXH5HMH=[LAAEEL LHf ÅLLH9H޻H٬HjH8EH[H51 @L HH Å;HjH5H81ˬfDL 11DHHDH5HZj1H81膬fHZH51kKfDH!jH5H81H(UHAUIATISHHHtPMt;LH t脧E~GI>DH5V1kPfDHeH5H81@-I>H51'ݦff.fUHATISHHdH%HE1HESt_HuL1HHSUHD|*H55HHsdHH81螦HUdH3%HEu%H[A\]fHAdH5H81h!UHSH軀Ht1 H[]苀1H1 H[]DUHHHXH`HhLpLxt )E)M)U)])e)m)u)}dH%HH1HEHH0H8HPH@HJcDž0Dž40H8&HHdH3 %u ffff.UHATISHHHUHDMu HtL`LH1[A\]UHSHHH=ťHtHH[]H[]@UHATIHSHtLHtHv"H=[HtHL[A\]DL@H8t[A\]UHATIHSH;tLHtH2vBH=>HtHL[A\]DHܰHL&[A\]@LHHtfDUHSHHH=HtHH[]H[]@HtH=LfDUH诶]H/ÐUH藶HH=HHHtH5UHt 1]DH=٣H5}uH=£H5vuH=H5ouH=H5mh]ff.H=iHtUHK]HOfDH9UHAWIAVIAUATASHH=UHH1MtIWH5RHIHE11ɺHLHAD$LLAAH߉EĺADžMȅIcH5&RHEHHDMĺHAVALHAXZEy#fDE111ҾH,tuH`ADžxH}DHQL詥AH>H5~QLHeD[A\A]A^A_]HEEyEH}ȹHH]H5IE1H81H=E1H]H DH5H;H;fffff.UHAUIATSHHHHtLE1䐋w !A9DLH0H{HuݸOAAEeAEH[A\A]]D'Aff.UHAWAVAUATSHHIAAH=OLL7HHEL%\ugZE11AHH5OHtYDHtJHI<$H5OH1mHH[A\A]A^A_]I $E11ҾHHI<$H5\OH1#I<$zH1fD1@H[H5N1H81ao@H=N,IHtD1LH5NHt$11H5NLt LDL L%A[LH5vN1I<$dI<$軟fDff.Kff.Kff.UHAVAUATSHIH{HI蠡LH蕡{H52NLdLHHt@LH5%NHrLLHtLH5qHbLLHTH[A\A]A^]H5H*Z1H81VH[A\A]A^]f.H59UHAUIATISH(dH%HE1HEEjH}кLyH}HHuMuKH}t\W1HtH}IE1111{EHMdH3 %u2H([A\A]]fDLLH1"fUHSHHϬHtH[HH[]ͶDH1[]ff.@UHSHHHtH HH[]MDH1[]ffffff.Fv1tÐwW1D1ff.fHtKUHSHHH?H{<H5KrHߺ=H5K^H[]ff.UHAVAUATSGHt+CE1E1LL[1A\A]A^]H?IItËCH;tt-׼DHsLLqIHuYCH;uHsLL`H;I蕼CMdE1LJHS[A\A]A^]{H;tRCLE1 fDHsLLH;ICMuUHAVAUATIH5BJSLH dH%HE1蘪0Ml$:E1LˠHHA|$:AtxuKaH5IL臚L1HMdH3 %H [A\A]A^]f.IHLM)HLBƄ%HdH{ZH5sIIlIMeH\/H5JI衙H=L~L6E1 14@UH5I1HSHiHHtH5ZHbuH1H[]DH5aHItH5HFtH5[HCtH5XH@tH5UH=tHA¸usUH=@HH0]H=ffUHAVIAUAATL%AS1A$~fDAfD1LA9 VUąt`AAAI~@HuLcH CHFHDHH *1ReAZA[ǨD ECtm ~2EIWEufDHHzAD9uLH Hu1L-DH57EL褕1(1DQE7HEdH3%He[A\A]A^A_]D0u辧LfDAD93/@E~nIW1A;u;HH9B0A9u-1HuLcAɿ1H Y*^19H SDIHu1LIDH %w-LcH jEM 8շHuH ]I1&ff.UHHAWI(AVIAULmATLSHCHHdH%HE1mxL_H:IHNiH!HHvHH1ɺH聘H1LvHfHLvHH11ҾeH7H1HMiHHNuH8|HMdH3 %HHH[A\A]A^A_]fL1LBH ,~HNH8蟒H1赘L}1@1@MH FL1E1'DLE1LBH z胏UHAWIAVI1AUMATMSLHHLdH%HE1MAH AHKHDHH1HE1=v*HUdH3%DH[A\A]A^A_]f+ : H)Ht(AHI1A)غH i Iغ1HH )A HL1H51A薎E1~LLLE1A11Ҿ LDDff.@UIȉH@HAVIAUIATE1SHHHdH%HE1ƛ=wLH b@1ILE1 HL1H5U@躍 LA11HMdH3 %DuH[A\A]A^]L;HAHt 1A0H H!%tDHJHDщAAHH+H IQLhHxLpI#DAGLHHX@I'<%u艓sHHDpMsDp>{AԪALA HCEw11ҾiH译H1_uLMOH 1LE1AH"H5;11ҾeHHH~GHkIHL0MAL7E ~1IH:9HMdH3 %DHx[A\A]A^A_]@H 9L1Ҿi躐} yDHH= HLNBL1LV<H Ҕ$LL1H LL1H H ;LLAE1PH+xLpLhA!H H!%tDHJHDщHH+E1HAy/HxuH8/tHxHxHAI9r/A/u(A/u!HA@A/uA/u II9uAHL=HL蠣r H諏Htx t H蓏HLtI1LL]:HCHx HPuDH: tHAH5:HH;HHH59HH@qLL1H 7LZL1H gLLH *9AVHH=R9L8LH L1HL1H YIL1L8H UI}f.LH joL1HH IXL1Lm8H 6IfDE1L7L1E1H H LLdHt"HH526H;蟆HLAHHHLHsLxLH OMOLH c8L)7I1MLHIE1HH"LMt$HxH5c53IH0HLAHLLH H.HxDLpD-DLpHItbDLpԆH܆DHHt8HǾ蠤LHņLpIH 1L1H gL1LH qLLH 5HH0螄HLIHyH5}L1言11Ҿ LHHׂHdH3%u}HH[A\A]A^A_]"oHLIHLHLH5|1LMw5/UA1HH 73H1]fH6H?DHHH}fUHAWAVAUIATIHSH}LAA@u.L14}HLH5[HA\1A]A^A_]2fH[A\A]A^A_]ÐH52L1 1L|H5ҊLH1~@L|H5{LI1~LL1H5~A9uHLH5-21[A\A]A^A_]~ffffff.uHHcHDHDH1HH1H1H1H1H1H1H1H1HZ1HH51H1H1H0UHSHHHfz/tHHBH9rH[]HH[]fDUHH=}H9t 'HnH}}]ff.HtsUL }MLH2H!%tHDHrHD־'@H1L)H)I<H%H>}]@H1}H)}H=Q}UHAUATISHH7FHt?IHHH;Ht$LtuCA[A\A]A^]@H5!nH={!1I4$Ht!H!H1II4$Hu[1A\A]A^]ff.UHAUIATISHH>Ht5H HH;Ht$LsuH[A\A]]H5ymH= 1kI4$H HtH1IJI4$HuH1[A\A]]@UHAWAVAUIATISHhdH%HE1z1HuLD0HnHU:uBL9t=HHHv;"t%IED3@HutDHH E1HxH ~xHxHm)E~xHxm)E~xHxHEHpx)EHpMIJ4(HHxoHxLHNtJIIuLH5kH=1D31HMdH3 %u1Hh[A\A]A^A_]DJL-LH5kH=Njff.UHATISHuHHdH%HE1tHMHcA $H9uHUdH3%u+H[A\]fDHH5kH=11iff.@UHHH=!kdH%HE1HuEBEHUdH3%uiifUHAWAVAUIATISHhdH%HE1ew1HuLD0HHU:uBL9t=HHHv;"t%IED3@HutDHVH E1HxHp~xHxH],k)E~xHxk)E~xHxHEHpx)EHpMIJ4(HHx mHxLH讍tJIIuLH56iH=1(D31HMdH3 %u1Hh[A\A]A^A_]DJL-LH5hH=rgff.UHAWAVAUIATISHhdH%HE1u1HuLD0H HU:uRL9tMHt?HuuHOHD1{ Aǃ-t#`H=H1迳NAAdA9D)HƄpLL1H=xHHHHEdH3%!HĈ[A\A]A^A_]DždH5/ZH=1!H=H9tH5ZH=z1HHtHHh#D{ A-H5UH=d1軲foAD$P dA)$A)D$A)D$ A)D$0A)D$@DH=nU1rH5kYL1a@H= 1JDHcdWff.@UHHHdH%HE1H`蒉ux1%=@HMdH3 %uWff.UHAWAVAUATSHXL5XdH%HE1HcXHXHL,IHt8-t.1HMdH3 %HX[A\A]A^A_]f.Sx-{XuxtL`HL`=LHEX8_HL@L1XL=XIHA<$hAD$E}uHH=Tt#HLLEHU]HULEAG -MaPуFH JHcHDH}WE1DDHLLEHUM]HULEtIIHuDHWHH WH.L% W@eHuL@AGCMtLH5VH= 1{IIHkHuLt\AG pbNuEIHqVH5V1H= @HuLdD@&ct%FEtFtAHEHULIHUH5UH=耮HuL4kL(HUH52UH= 1$@HuL\OD.MtsL4U6UU&IHUH5T1H=d语KrSHTMH5T1H=胭H5tTH= 1fLH5TTH=! 1FUUHAWAAVMAUEATSH0MH]dH%HE1SSZYAău {"H;H5UH Ht3D;=~PHiD;x6HHHuAA GA 11E1Df1=.v<=!=uJLEْgH;H7U%D=uLq^H;HUfDUH;H51 REH*H;HHDH5p1QH]dH3%DHe[A\A]A^A_]Ð11AAE1AAfDAA FA `AVE1A uvHb Ht'D;-^ t%HM  D;htHHHuHH;H5&1QfAAtE1AAH;HH51DEHMPHMDE&0XIHLH]HE葲111ILE1MLuHUH;H51^P9fE.AFH;AAń+HH5\1$PHmHt.D;-iHT fD;hHHHuH AVA6Ht&;tH @;Pt HHHuHHt095HfD;pHHHuH;DH51_O:f.DXHtnH;H(RE1H;H51ODH5`1NH;HuH5 1NDdH;H51NpNH=!PHt4UH1H5KzHNH=P11Ҿ ]UfH1 H5H81XNUHAWAVAUATSHHH}SHu7fHHCHHuL% E1f.HK8HS0AHs(H}I<$DH5A1Mz>H{(I>LI<$L1H I<$H5JPHfHIHt5H [EouH I<$H5 1I^MIHuI<$H51DMH}11Ҿc貋AH5HI<$HEOAu'H[PHH[A\A]A^A_]fDHs(H} t?Hs0H} t.C@u_HK8HtH}ȺXHufD1H[A\A]A^A_]I<$H5 1^LTfH}11Ҿi辊H61뫐UHSHHHH5HH H81L׀UHAWAAVAUIATIHSHHdH%HE1E4HE1E11j11L AYAZAƅu/HMdH3 %He[A\A]A^A_]H5CLANH5?L*NEHE1HEHEHEHEHEHEHEEHuHMLME1LHUOY^tH5VLMEU - HHcHH5LyMfD9lH5RGLUMH5LAMH5L)MH5cLMH58LLH5 LLl@}ātH+DLH5oU1I}^H5LH1kIfDHuHUE1LMLHMXZ\fH]nto^HHsULH51H}oUH5L1HYf~*?Ho@zfDHX\HE1LE1j11Ҿ_AXAƅH58L.KfH@H)t@Hod@HT@H?DGff.@UHAWAVAUIATSHHRLIW]LALEHxt+t'A+H DHcHf.L5!U1H5I>EGM7LHEEI>HM1HzI>H5CIuIcI>DH5H1FHQx ;EH;1ۋp D`A+HȾEJcHEHA܋PHD[A\A]A^A_]HA܋HtfAMtL%H5I<$I6LIDI<$L1H`I<$H5BAHlsML%H51I<$ELJI<$HJI<$H5B1EI>H5@qHq@LWH@HH54H81DEMtH5@1EL装I>H訅I>H5A1DAHQ@A+wDHEJcHLVhM{DH D`EtE1LVff.UHAUATSHHt@IԺIHۦ~?MLLDLЦ~tLԦÅtFH[A\A]]@L%HH511I<$CI<$AFHH5*H81CfDHyLH5ߣ1H;CH;1EH[A\A]]fDUHAWAVAUE1ATSHHAIHtcEIIHkTLHU~THܥAƅMtLXHNHEuAAHD[A\A]A^A_]ÐHH5H;1E1BH;E1LiHVNHuHbH5S?HQH5zHAH5ҢH81hBpH!H5H;E1GBH;DGf.UHAWAVAULmATIHSHH8dH%HE1^1HLuLHL1LlHCHt }1L龍H!Htff.@U1HAVAUHMATIHoSHdH%HE1\}H5LA1AL5B<H5^L1>HEA9tH}\|C~a=H]H}LEPHH5~g荞eH} aHH5L1;8@H}WHtH5gLHHDH1L;H}c<Hxz=HUdH3%Hp[A\]@H}o`H5BL1:f.H}G`H}<{PH5&LH1:^f.H}`H5L1:311H߾xH߉-H5eLH1I:@?fE9ff.fUHAWIAVIAUAATISH~HHcEHEHAAAunuNIF H8tYE1fM~HLHH51MM>IMGIAPMm9AWI7H~tIF ZYL9(wHEHe[A\A]A^A_]AuEH}HEHMLLH5!LAQH18HELHHtAZA[fDMEIF E1H8ofM~HLHH5Ù1MM>IMGIAPM8AWI7HsIF _AXL9(wDI~ IDML@HoDDMMLLH5|H1*8DDmE~/H}t(HEHMLLH5hLAQfDDMMLLH5tH17rDI~bIDML@HdfUHAUATASHHu HHHD@@tWHDHHD*DI/MHH5HHH8H1[A\A]]7@tEtFx\H[A\A]]fHH5tHHH8H1[A\A]]6軙HH5`H@裙HH5YH@UHAWL=SAVIAUMATSHLedH%HE1H'LDu H#Ht';5 t&H D;ptHHHuH]IL@Ѿ1HLL8ZCHnBL8HfPLMHRH5L1T5_AXMp11Ҿ LpI1Mt/HuLotH}LkE*HH߉E+Ly+EH[A\A]A^A_]IHupHHt\MLUtLHLUE1tLUMtLHE1tM@H7E11ZfDoIHtMtLH蓁/MtLL苁H}1E1fDUHSHHH55HHHHH5HBHHH5[]鍁ff.fUHATISHH=%HtHtOMtJH5 ML%HTHtg11ҾH&$t"HH5À[1A\]@1[A\]ÐH=H5}H=11Ҿ #fDH1LH5H81Uff.UHAWAVAUIHATSHH~H2.H߅HHEI"HtHIu&HF~H[A\A]A^A_]LH5&L11L5>fK LIkL1LH[LLL9H[A\A]A^A_]HLL1[H5|~A\A]A^A_].ff.UHATIHSH+buH?Z=@1H1ɾLgYH'[LHHA\]HDH5T~1D[LH5e~A\1]UHATISHdH%HE1~1LH~?w HHUHuH11Ҿ H!HMdH3 %u H[A\]UHAWAVIAUE1ATISHHXHE0HMLEDMHEdH%HE1HEHE+~t&HMdH3 %DHe[A\A]A^A_]ÐHAHEDMPDELHߋM1}[A\HEH EH]H@EE1EDME8DEEs}PL}ML}HA}}A9L|}IHuE1Hi}HHuA>~H}KE@H}L%k$uHEHn%H}HHDHE|HZ t,H}|HKtH}|H*HEHLMM1HMH5}H; f.H߃E|H߉E|HAn|U1D|AsL|A>H|HK|M(t)Hc|UA>H^U H}H/|HG|HMH{H|H3|HHt/HHH5,H81H5H H}Ht{H}{Uu 0D‰EDHHEDMDEMHuP1H}{AZA[&H:E1H8{fH!H;E1bfHzH߉EzH߉EzUu1ɉzA6M[M3fDHxz;EtH5H=z*Hhz;EDH`z;E|DHQE1H8fA>MYAfMwH H5LE1H81-A>YA2H!HEIxE:A>bYA0UHAUAATISHHdH%HE1HtHHtH^XHHEHtDHU1TXH}Ѕu$WVHEdH3%u?H[A\A]]DMtYyH}I$HtbyH}H@UHAWAAVAAUATIS1H8uH5>dH%HE1~AAEEuVH5L11 L11AHMdH3 %H8[A\A]A^A_]DxH5L1`Df}HUHu`H]HtLmMtv:HQLHLHH5BHBHE1E1AH} H5H} H5ECH5L1E1]ff.fUHAWE1AVEAUATISHHHHEHHHEDHHE(HdH%HE1HDžvt'HMdH3 %DHe[A\A]A^A_]fHAŋHHDEPH=vY^ADž8HEft3v9HuHvHAuHvHHuH‹E0&A#A! AEHtHHuHD91DuJDHDHuADžHuH=H8THHHH;RHtD9'Ht; HZHsHt1fDH1HDžADžMt A$H0De DHHHHEHKE1AtAAHHAEEuHH;PRHHHkLD1t&Iu1҉,txE1AtAAžLctIHHоARٸDe fo 3HHKDIADI)fDH@}iH~^Lf11LD))) )0)@)P)`)pN RDDDe RaEQ$H9H8MHE1urHH8HHHHq;H0 HuqADf5QHH8HOHOAHaH8P-E1PH4H8 HpH pHq1D Ipu=1DpA HH5H=q L%UHATASHHHqx [A\]H~P wLHHЩ u[A\]fHdUHAWAVAUIATISHpHtuLHpIHtbI}uuA}tnHLApHuAA}uAELp=HH5`H81 E1HD[A\A]A^A_]DL5H51I> I>H51 I>H)I>H51{ I>L)I>H5K1_ ,f.+pIsIkMtVHHEpLMȅu^LjLbL pDHH5oH81 H(L 1o1LHELMȃuMHLoLMȅl1LLELMȃAOMLMHLLtoLMȅ&LϾ;LMȅ LHToLMȅL` LX Lo$LC 1< Ln1UHATIH5TSH dH%HE1r1HMоHI$HHEH/HE)fx%HHUdH3%Hu=H [A\]@HH5ZH818H1ۺmH5B ff.UHATISHHHCHHHHHPHp LH(L@nxMHCHH5mE1HH(HyH81H{mHCHD[A\]A$PAH}mH5(AHHHH81@fDHH5 AH81nDUHAVAAUEATSHHHu؅uHvWmAątxHuDvHDnHuHmH5HImHEHߋpJmE uHEA@uH5HA/mHD[A\A]A^]H)H5SH81PHD[A\A]A^]H5l@UHAUIATIHSHHHulHCHEHxH@HHt~LluBH L1HuLElLH5lH[A\A]]fDH_LH5lH81H1[A\A]]fDH1H5kH81XH1[A\A]]ff.UHATISHHzkH{H3lHCHtHP([LH5A\1]@[LH5A\1]H\$Ld$L%Hl$H1HL)HH9sHAHH9rH$Hl$Ld$HfffffffUHH-H)SHHXHTHHuH[]KHHt3UHS NHDHHHuH[]f.HoHapps/lib/cmp_mock_srv.cmock server received error: pkiStatusInfo absent pkiStatusInfo: %s errorCode absent errorCode: %ld errorDetails absent errorDetails: , profile1wrong certificate to revoke%s: Use -help for summary. Unknown item name %s Supported types: %s Error reading PEM file asn1defaultCan't find 'asn1' in '%s' '%s' is out of range Error parsing structure Can't parse %s type Error: offset out of range Error writing output Error parsing item %s apps/asn1parse.cGeneral options: helpDisplay this summaryoidfile of extra oid definitionsI/O options: informininput fileoutnooutdo not produce any outputoffsetoffset into filelengthlength of section in filestrparsegenstrgenconfstrictpemitemitem to parse and print(-inform will be ignored)Formatting options: iindents the outputdumpunknown data in hex formdlimitkeyTimeholdInstructionCAkeyTimeapps/ca.c00Memory allocation failure Vrow exp_dataunknownrow ptrfailed to update database TXT_DB error number %ld ERROR:name does not match %s Revoking Certificate %s. Unknown CRL reason %s Invalid object identifier %s revocation reason,NULLValidRevokedExpiredundefsubjectPRINTABLE:'T61STRING:'IA5STRING:'UNIVERSALSTRING:'ASN.1 %2d:'' %c\0x%02X^%coptionalsuppliedmatchType :%s Was revoked on:%s Expires on :%s Serial Number :%s File name :%s Subject Name :%s Certificate Details: (%ld days)Sign the certificate? [y/n]:row expdaterow spacecertificate requestError unpacking public key Signature ok %s=Expired memory allocation failure invalid revocation date %s missing hold instruction invalid object identifier %s missing compromised time invalid compromised time %s invalid reason code %s default_cacaoid_filerstring_maskutf8unique_subjectdatabaserow serial#Serial %s not present in db. %s=Valid (%c) %s=Revoked (%c) %s=Expired (%c) %s=Suspended (%c) %s=Unknown (%c). Error verifying serial %s! private_keyError getting password CA private keycertificateCA certificatepreservemsie_hackname_optInvalid name options: "%s" cert_optcopy_extensionsnew_certs_dir%s: %s is not a directory generating index Updating %s ... Malloc failure newoldextensionsUNDEFdefault_mdno default digest email_in_dnmessage digest is %s policy is %s rand_serialserialx509_extensionsdefault_startdatedefault_enddatedefault_daysnext serial number is 00 next serial number is %s error on line %ld of %s SPKACtemplate certificateerror unpacking public key CERTIFICATION CANCELED /writing new certificates writing %s wDatabase updated crl_extensionscrlnumberdefault_crl_daysdefault_crl_hoursmaking CRL error setting CRL lastUpdate error setting CRL nextUpdate signing CRL no input files certificate to be revoked in entry %d policyunspecifiedkeyCompromiseCACompromiseaffiliationChangedsupersededcessationOfOperationcertificateHoldremoveFromCRLverbosequietoutdirWhere to put output certThe input cert request(s)infilesdateoptnotextbatchDon't ask questionsss_certspkacengineConfiguration options: configA config filenamesectionAn alias for -nameThe CA 'policy' to supportCertificate options: subjcreate_serialmultivalue-rdnstartdatenot_beforeAn alias for -startdateenddatenot_afterAn alias for -enddatedaysextfilepreserveDNDon't re-order the DNnoemailDNSigning options: mdDigest to use, such as sha256keyfileThe CA private keykeyformpassinkeycertThe CA certcertformselfsignsigoptvfyoptRevocation options: gencrlGenerate a new CRLvalidstatusupdatedbUpdates db for expired certcrlextscrl_reasoncrl_holdcrl_compromisecrl_CA_compromisecrl_lastupdatecrl_nextupdatecrldayscrlhourscrlsecrevokeRevoke a cert (given in file)Random state options: randwriterandProvider options: provider-pathproviderprovparampropqueryParameters: certreqUNKNOWNOpenSSL cipher name: %s Error in cipher list :%s 0x%02X,0x%02X - %-45s - Usage: %s [options] [cipher] Output options: vEven more verbosestdnameShow standard cipher namesconvertsOnly supported cipherstls1Ciphers compatible with TLS1tls1_1tls1_2tls1_3psksrpciphersuitesciphererrorapps/cmp.cinfo%s:%s:%d:CMP %s: %s %s%s deletingwritingwarningactually sendingactually using%s certificatePBMAC secret of mock servercerts trusted by mock servercaPubs for mock servercertificate to be updatedissuerPKCS#10 CSRcriticalSubject Alternative Namehttp%s://%s:%s/%s via %sp10crgenmuntrusted certificatescerts trusted by clienttrusted TLS certsdebugextra certificates for TLSTLS client private keyPBMACextra certificates for CMPrecipientexpected senderint:str:verbosity from -%sUse -help for summary. pkix/Not FoundInternal Server Errorapplication/pkixcmpCANewWithNew cert from genpNewWithOld cert from genpOldWithNew cert from genpCRL from genp of type 'crls'certTemplate from genpkeySpec from genpwb%s:%s:%d:CMP %s: No %s%s%s Key %s: Key algorithm: - Key algorithm: RSA %d Invalid key spec: %s End of key %s%s:%s:%d:CMP %s: %.*s%s PKIStatusInfo bufvalidated serverextranewly enrolled cert and chainchainnewly enrolledAES-256-CBCGeneric message options: cmdinfotypeprofilegeninfotemplatekeyspecnewkeynewkeypasscentralkeygennewkeyoutreqextssanssan_nodefaultpoliciespolicy_oidspolicy_oids_criticalpopocsrout_trustedimplicit_confirmdisable_confirmcertoutchainoutoldcertrevreasonMessage transfer options: serverproxyno_proxypathkeep_alivemsg_timeouttotal_timeouttrustedunless -srvcert is givenuntrustedsrvcertexpect_senderignore_keyusageunprotected_errorsno_cache_extracertssrvcertoutextracertsoutcacertsoutoldwitholdnewwithnewnewwitholdoldwithnewcrlcertoldcrlcrloutrefsecretown_trustedkeypassdigestmacextracertsunprotected_requestsCredentials format options: crlformotherpassTLS connection options: tls_usedtls_certtls_keytls_keypasstls_extratls_trustedtls_hostrepeatreqinreqin_new_tidreqoutreqout_onlyrspinrspoutuse_mock_srvMock server options: portmax_msgssrv_refsrv_secretsrv_certCertificate of the serversrv_keysrv_keypasssrv_trustedsrv_untrustedref_certrsp_certrsp_keyrsp_keypassrsp_crlrsp_extracertsrsp_capubsrsp_newwithnewrsp_newwitholdrsp_oldwithnewpoll_countcheck_aftergrant_implicitconfpkistatusfailurefailurebitsstatusstringsend_errorsend_unprotectedsend_unprot_erraccept_unprotectedaccept_unprot_erraccept_raverifiedValidation options: purposecertificate chain purposeverify_nameverification policy nameverify_depthchain depth limitauth_levelattimeverification epoch timeverify_hostnameexpected peer hostnameverify_emailexpected peer emailverify_ipexpected peer IP addressignore_criticalissuer_checks(deprecated)crl_checkcrl_check_allcheck full chain revocationpolicy_checkperform rfc5280 policy checksexplicit_policyinhibit_anyinhibit_mapx509_strictextended_crlenable extended CRL featuresuse_deltasuse delta CRLspolicy_printcheck_ss_sigcheck root CA self-signaturestrusted_firstsuiteB_128_onlySuite B 128-bit-only modesuiteB_128suiteB_192Suite B 192-bit-only modepartial_chainno_alt_chainsno_check_timeallow_proxy_certsDERPEMcmpBad input format for %s rbCAdESCMSInvalid key %s Invalid id %s Invalid OID %s recipient certificate fileNo key specified key param bufferapps/cms.cNo secret key id certificate fileoriginator certificate filesigning keySMIMECan't read content file %s Error writing certs to %s Can't open receipt file %s receiptparameter error "%s" signer certificateError creating CMS structure Verification successful Verification failure %s Verification successful %s Verification failure Error writing signers to %s Signer %d: No Receipt Request Signed Content ID: Receipts From List: : First Tier : All Unknown (%d) Receipts To: To: %s%sFrom: %s%sSubject: %s%sError writing CMS output Input fileOutput fileOperation options: encryptEncrypt messagedecryptDecrypt encrypted messagesignSign messageverifyVerify signed messageresignResign a signed messagesign_receiptverify_receiptdigest_createdigest_verifycompressuncompressEncryptedData_encryptEncryptedData_decryptdata_createCreate a CMS "Data" objectdata_outcmsoutOutput CMS structureFile format options: outformrctformReceipt file formatstreamEnable CMS streamingindefSame as -streamnoindefDisable CMS streamingbinarycrlfeolasciicrlfKeys and passwords options: pwri_passwordsecretkeysecretkeyidinkeyInput file pass phrase sourcekeyoptoriginatorOriginator certificate filerecipRecipient cert filecert...wrapaes128-wrapUse AES128 to wrap keyaes192-wrapUse AES192 to wrap keyaes256-wrapUse AES256 to wrap keydes3-wrapUse 3DES-EDE to wrap keydebug_decryptDigest algorithm to usesignerSigner certificate input filecertfilecadesnodetachUse opaque signingnocertsnoattrnosmimecapno_signing_timereceipt_request_allreceipt_request_firstreceipt_request_fromreceipt_request_toVerification options: contentno_content_verifyno_attr_verifynosigsnoverifynointernverify_retcodeCAfileTrusted certificates fileCApathCAstoreno-CAfileno-CApathno-CAstorekeyidUse subject key identifierecontent_typeOID for external contenttextcertsoutCertificate output filetoTo addressfromFrom addressSubjectPrinting options: printnameoptreceipt_request_printPrint CMS Receipt RequestCRLverify failure verify OK Missing CRL signing key other CRLCRL signing keyError creating delta CRL issuer=crlNumber=0xissuer name hash=%08lx issuer name old hash=lastUpdate=nextUpdate=NONEout of memory %s Fingerprint=%02X%cunable to write CRL Verify CRL signatureInput options: Input file - default stdinoutput file - default stdoutOutput format - default PEMhashPrint hash valuehash_oldAny supported digestCRL options: Print issuer DNlastupdateSet lastUpdate fieldnextupdateSet nextUpdate fieldNo CRL outputfingerprintPrint the crl fingerprintPrint CRL numberbadsiggendeltaunable to load CRL error opening the file, %s error reading the file, %s error loading certificates unable to write pkcs7 object Input format - DER or PEMnocrlOutput format - DER or PEM\ *%s apps/dgst.c%02x(%s)= %s(%s)= rsaRSA-%-25s Read error in %s Verified OK Error verifying data Signature bufferError signing data Digest bufferError Digesting Data etaonrishdlcupfmSHA256I/O bufferSupported digests: public keyprivate keyMAC parameter error "%s" Error getting context Error setting context Error setting digest signature bufferstdinlistList digestsengine_implchexPrint as hex dumpPrint in binary formxoflendPrint debug infoSign digest using private keyprverifysignatureFile with signature to verifyhmacCreate hashed MAC with keymacoptfips-fingerprintfilepqgDHXDSADHsafe checkCheck the DH parametersdsaparamInput format, DER or PEMOutput format, DER or PEM235Verbose outputTerse outputnumbitstype-specificSubjectPublicKeyInfoMSBLOBPVKError getting passwords unable to load Key Not a DSA key pubPublic Key=writing DSA key %s format not supported encrypt-levelinvalid PVK encryption level unable to write key apps/dsa.cread DSA key Any supported cipherpvk-strongpvk-weakpvk-noneDon't enforce PVK encodingInput keypubinOutput format, DER PEM PVKDon't print key outPrint the key in textmodulusPrint the DSA public valuepuboutpassoutThis could take some time DSA parametersPrint as textNo outputgenkeyGenerate a DSA keynumqbitspoint-formatencodinginclude-publicunable to print EC key unable to check EC key EC Key Invalid! EC Key valid. writing EC key unable to write EC key apps/ec.cread EC key check key consistencyparam_encconv_formPrint the keyparam_outno_publicnamed_curveexplicituncompressedcompressedhybridprime192v1prime256v1list curvesapps/ecparam.c %-10s: %s secp192r1secp256r1groupSM2sm2ecunable to generate key EC parametersECSM2 parametersseedunable to clear seed unable to print params namedgroup-checkunable to set check_type failed ok list_curvesGenerate ec keyInput file - default stdinOutput file - default stdoutDo not print the ec parameterParameter options: Validate the ec parameterscheck_namedno_seednon-hex digit base64Supported ciphers: %s Can't read key from %s %s: out of memory bufsize=%d strbufevp bufferUnstreamable cipher mode encryptiondecryptionenter %s %s password:bad password read invalid hex salt value RAND_bytes failed error writing output file error reading input file bad magic number PKCS5_PBKDF2_HMAC failed EVP_BytesToKey failed invalid hex iv value iv undefined invalid hex key value Error setting cipher %s salt=%02Xkey=iv =bad encrypt bad decrypt bytes read : %8ju bytes written: %8ju apps/enc.c%s: zero length password List ciphersciphersAlias for -listeEncryptDecryptPrint the iv/keyPPrint the iv/key and exitkPassphrasekfileRead passphrase from filepassPassphrase sourceaSame as option -aAEncryption options: nopadsaltUse salt in the KDF (default)nosaltDo not use salt in the KDFbufsizeBuffer sizeKRaw key, in hexSSalt, in hexivIV in hexiterDefault: 10000pbkdf2noneDon't encryptsaltlenDefault: 16skeyoptskeymgmtengine bufferapps/engine.cSTORE(%s)[Success]: %s [Failure]: %s (%s) %s Loaded: (%s) %s RAND [%s] [ available ] [ unavailable ] name bufferdescription buffer%s: %s %s%s(input flags): [Internal] NUMERIC|STRINGNO_INPUT <0x%04X>tprepostvvvvvvvvvttID of engine(s) to load%lxerrnumError number(s) to decodest-phasest-descst-typeStart%s : (%s) : PassFailCorrupt%s %s = %s apps/fipsinstall.c10[%s] activate = 1 install-versionconditional-errorssecurity-checkshmac-key-checkkmac-key-checktls1-prf-ems-checkno-short-macdrbg-no-trunc-mdsignature-digest-checkhkdf-digest-checktls13-kdf-digest-checktls1-prf-digest-checksshkdf-digest-checksskdf-digest-checkx963kdf-digest-checkdsa-sign-disabledtdes-encrypt-disabledrsa-pkcs15-pad-disabledrsa-pss-saltlen-checkrsa-sign-x931-pad-disabledhkdf-key-checkkbkdf-key-checktls13-kdf-key-checktls1-prf-key-checksshkdf-key-checksskdf-key-checkx963kdf-key-checkx942kdf-key-checkpbkdf2-lower-bound-checkecdh-cofactor-checkmodule-macinstall-macINSTALL_SELF_TEST_KATS_RUNinstall-statusfipsHMACfips_sectINSTALLVERIFYno_conditional_errorsno_security_checksno_pbkdf2_lower_bound_checkhexkey:digest:self_test_oninstalldigest:SHA256Failed to open module file Unable to get MAC of type %s MAC parameter error Unable to create memory BIO version not found Module integrity mismatch install status not found VERIFY PASSED openssl_conf = openssl_init [openssl_init] [provider_section] %s = %s Failed to load FIPS module versionbuildinfoname: %-10s %s version:build:3.0.Failed to open file INSTALL PASSED %s FAILED not availableFIPS provider is %s availablepedanticmoduleprovider_nameFIPS provider namesection_nameself_test_onloadems_checkno_short_macDisallow short MAC outputno_drbg_truncated_digestssignature_digest_checkhmac_key_checkEnable key check for HMACkmac_key_checkEnable key check for KMAChkdf_digest_checkEnable digest check for HKDFtls13_kdf_digest_checktls1_prf_digest_checksshkdf_digest_checksskdf_digest_checkEnable digest check for SSKDFx963kdf_digest_checkdsa_sign_disabledDisallow DSA signingtdes_encrypt_disabledrsa_pkcs15_padding_disabledrsa_pss_saltlen_checkrsa_sign_x931_disabledhkdf_key_checkEnable key check for HKDFkbkdf_key_checkEnable key check for KBKDFtls13_kdf_key_checktls1_prf_key_checkEnable key check for TLS1-PRFsshkdf_key_checkEnable key check for SSHKDFsskdf_key_checkEnable key check for SSKDFx963kdf_key_checkEnable key check for X963KDFx942kdf_key_checkEnable key check for X942KDFecdh_cofactor_checkmac_nameMAC namecorrupt_desccorrupt_typeCorrupt a self test by typeThe parent config to verifyNo messages, just exit statusparams fileapps/gendsa.cdsaparam-fileAlgorithm already set! %s%s:%s Parameters already set! Can't open parameter file %s Error initializing context Bad format specified for key Error writing key(s) Error printing key apps/genpkey.cintuintfloatstringparamfileParameters filealgorithmThe public key algorithmpkeyoptOutput (private key) fileoutpubkeyOutput public key fileoutput format (DER or PEM)genparamGenerate parameters, not keyPrint the private key in textError setting RSA length Error cannot access RSA e e is %s (0x%s) apps/genrsa.cUsage: %s [options] numbits F4f4primesSpecify number of primestraditionalSize of key in bitsUndefined%s: Only one item allowed %s: No items chosen configdirenginesdirmodulesdirdsoextdirnamesepDirectory-filename separatorlistsepList separator characterseedsSeed sourcescpusettingsCPU settings infowindowscontextWindows install contextalgorithm name%s:%sapps/kdf.cInvalid KDF name %s KDF parameter error Invalid derived key length. out bufferEVP_KDF_derive failed %s Usage: %s [options] kdf_name kdfoptCipherDigestMACkeylenkdf_nameName of the KDF algorithm%s: %s @ %s state = %s stateERROR: Memory allocation %sLegacy: %sProvided: description: %s settable operation parametersProvided KDFs and PDFs: Provided MACs: %-*sProvided ENCODERs: @ %s (%s) Provided DECODERs: Name: Type: Provider Algorithm IDs: - TLS-SIGALGtls-sigalg-iana-nameProvided STORE LOADERs: %s %s => %s ExternalBuiltin(none)- - %s %c Digests: Symmetric Ciphers: Provided Key Exchange: Provided Signatures: Provided Key encapsulation: Provided Key managers: primarypublicprivateapps/list.c%s%cProvided: Key Managers: Legacy: Name: %s Alias for: %s Type: %s Algorithm OID: %s PEM string: %s Encryption: Key Exchange: Signatures: Key encapsulation: %s Providers: name: %s version: %s status: %sactive build info: %s gettable provider parametersEngines: Disabled algorithms: GOST IDEA MD2 MDC2 RC5 SCTP SSL3 ZLIB BROTLI ZSTD # None-OID object: %s, %s %s = %s, %s uninitialisedreadyList in one columnVerbose listingselectSelect a single algorithmcommandsList of standard commandsstandard-commandsall-algorithmsList of all algorithmsdigest-commandsdigest-algorithmskdf-algorithmsrandom-instancesrandom-generatorsmac-algorithmscipher-commandscipher-algorithmsencodersList of encoding methodsdecodersList of decoding methodskey-managersList of key managersskey-managerskey-exchange-algorithmskem-algorithmssignature-algorithmsList of signature algorithmstls-signature-algorithmsasymcipher-algorithmspublic-key-algorithmsList of public key algorithmspublic-key-methodsList of public key methodsstore-loadersList of store loaderstls-groupsall-tls-groupsprovidersList of provider informationenginesList of loaded enginesdisabledList of disabled featuresoptionsobjectsapps/mac.cInvalid MAC name %s EVP_MAC_Init failed Read Error in '%s' EVP_MAC_update failed EVP_MAC_final failed output len is too large Usage: %s [options] mac_name MAC algorithmtoseqOutput NS Sequence fileapps/ocsp.cissuer certificateError Creating OCSP request Error reading OCSP request responder certificateCA certificatesresponder other certificatesresponder private keyindex file changed, reloadingapplication/ocsp-responsesigner private keysigner certificatesError signing OCSP request assertion failed: bnassertion failed: itmpError creating SSL context. application/ocsp-requestError reading OCSP response Responder Error: %s (%d) validator certificatesError parsing response Nonce Verify error Response Verify Failure Response verify OK %s: ERROR: No Status found. This Update: Next Update: Reason: %s Revocation Time: ignore_errResponder options: timeoutresp_no_certsmultino_certsnminnrequestsign_otherindexCertificate status index filendaysrsignerrkeyrotherrmdrsigoptheaderkey=value header to addrcidClient options: urlResponder URLhostPort to run responder onPath to use in OCSP requestOutput filenameDon't verify response at allnonceAdd OCSP nonce to requestno_nonceno_signature_verifyresp_key_idno_cert_verifyreq_textPrint text form of requestresp_textPrint text form of responseno_chainDon't chain verify responseno_cert_checksno_explicittrust_otherno_internrespinVAfileValidator certificates fileverify_othervalidity_periodsignkeyrespoutIssuer certificatestatus_ageMaximum status age in secondsno-The command %s is deprecated. Use '%s' instead.apps_startupprog_initOPENSSL_TEST_LIBCTX-help--help-version--versionapps/openssl.cUsage: %s %s: Standard commandscommandapps/passwd.capr16salt bufferrounds=%u%s %s password bufferPassword: Read passwords from fileRead passwords from stdinNo warningstableFormat output as tablereverseSwitch table columnsCryptographic options: Use provided saltMD5-based password algorithmaixmd5password, , %s, %s, Iteration %ld, PRF %s, Iteration %ldapps/pkcs12.c%.*s %02X %s (%s) : Key bag Bag Attributes%s: %s: Key AttributesShrouded Keybag: Certificate bag Secret bag Bag Type: Bag Value: Safe Contents bag PKCS7 Data PKCS7 Encrypted data: sha1private key from -in fileprivate key from -inkey fileUnknown PBE algorithm %s nomacverclcertscacertspasscertscanameCSPLMKkeyexkeysigkeypbecertpbe and -descertmacalgiter and -noiternomaciternomacmacsaltlenlegacyEnter MAC Password:Can't read Password certificates from -in fileError getting chain: %s Enter Export Password:Error creating PBMAC1 Enter Import Password:MAC: using PBKDF2, Iteration %ld PBKDF2 PRF: %s , Iteration %ld Warning: MAC is absent! PKCS12KDFtwopassnokeysDon't output private keysDon't output certificatesDon't verify integrity MACOnly output CA certificatesnoencDon't encrypt private keysnodesexportCreate PKCS12 filePEM-format file of CA'sPEM-format directory of CA'sURI to store of CA'sUse name as friendly nameMicrosoft CSP namecertpbedescertpbmac1_pbkdf2pbmac1_pbkdf2_mdnoiterDon't use MAC iteration)maciterSpecify the salt len for MACDon't generate MACjdktrustunable to load PKCS7 object Don't output encoded dataprint_certs%s: Unknown PBE algorithm %s %s: Unknown PRF algorithm %s Error converting key Error setting PBE algorithm Enter Encryption Password:Error encrypting key Error reading key Enter Password:Error decrypting key apps/pkcs8.cv1Use PKCS#5 v1.5 and cipherv2Use PKCS#5 v2.0 and cipherv2prfInput format (DER or PEM)nocryptOutput format (DER or PEM)topk8Output PKCS8 fileSpecify the iteration countUse 1 as iteration countScrypt options: scryptUse scrypt algorithmscrypt_NSet scrypt N parameterscrypt_rSet scrypt r parameterscrypt_pSet scrypt p parameterPublic KeyKey is valid Key is invalid apps/pkey.cCheck key consistencypubcheckCheck public key consistencyKey input pass phrase sourcetext_pubec_conv_formec_param_encError reading parameters Parameters are valid Parameters are invalid Check key param consistencyPrint parameters as textoneshot sign/verify bufferError reading raw input data buffer outputError signing raw input data apps/pkeyutl.c(unknown key type)Certificate%s: Error loading key Error: out of memory peer keyError reading peer key %s Enter %s: user abort entry failed failed to get '%s' Can't open signature file %s Error reading signature data Error reading input Data secret outputPublic Key operation error Key derivation failed Verify with public keyderivedecapDecapsulate shared secretencapEncapsulate shared secretInput key is a public keypeerkeypeerformcertinrevsigfileasn1parsehexdumpHex dump outputverifyrecoverrawinpkeyopt_passinkdfUse KDF algorithmkdflenKDF algorithm output lengthkemopMissing number (s) to check Specify the number of bits. Out of memory. Failed to generate prime. apps/prime.cFailed to process value (%s) Error checking prime is (%s) %s prime is notbitsSize of number in bitschecksNumber of checksHex outputgenerateGenerate a primesafenumbercmscrlcrl2pkcs7dgstdhparamdsaecparamencerrstrfipsinstallgendsagenpkeygenrsanseqocsppasswdpkcs12pkcs7pkcs8pkeypkeyparampkeyutlprimerehashreqrsautl3.0s_clients_servers_timesess_idskeyutlsmimespeedstoreutltsx509md4md5sha224sha256sha384sha512sha512-224sha512-256sha3-224sha3-256sha3-384sha3-512shake128shake256rmd160blake2b512blake2s256sm3aes-128-cbcaes-128-ecbaes-192-cbcaes-192-ecbaes-256-cbcaes-256-ecbaria-128-cbcaria-128-cfbaria-128-ctraria-128-ecbaria-128-ofbaria-128-cfb1aria-128-cfb8aria-192-cbcaria-192-cfbaria-192-ctraria-192-ecbaria-192-ofbaria-192-cfb1aria-192-cfb8aria-256-cbcaria-256-cfbaria-256-ctraria-256-ecbaria-256-ofbaria-256-cfb1aria-256-cfb8camellia-128-cbccamellia-128-ecbcamellia-192-cbccamellia-192-ecbcamellia-256-cbccamellia-256-ecbdesdes3desxrc4rc4-40rc2bfcastdes-ecbdes-ededes-ede3des-cbcdes-ede-cbcdes-ede3-cbcdes-cfbdes-ede-cfbdes-ede3-cfbdes-ofbdes-ede-ofbdes-ede3-ofbseed-cbcseed-ecbseed-cfbseed-ofbrc2-cbcrc2-ecbrc2-cfbrc2-ofbrc2-64-cbcrc2-40-cbcbf-cbcbf-ecbbf-cfbbf-ofbcast5-cbccast5-ecbcast5-cfbcast5-ofbcast-cbcsm4-cbcsm4-ecbsm4-cfbsm4-ofbsm4-ctrInvalid size suffix %s buffer for output fileapps/rand.cBase64 encode outputHex encode outputnumNumber of bytes to generateapps/rehash.ccollision buckethash bucketSkipping %s, can't write Doing %s Skipping %s, out of memory filename buffer%s%s%s%08x.%s%dlink %s -> %s %s%s%08x.%s%d%s: Can't unlink %s, %s %s: Can't symlink %s, %s unlink %s hcompatnDo not remove existing linksdirectorypemcrtcerapps/req.c%s [%s]:%s '%s' too long req_extensionsrequestCan't find keygen engine %s Serial number supplied twice Duplicate extension name: %s Unknown cipher: %s input_passwordoutput_passworddefault_bitsparamUnable to determine key type Out of memory RSA-PSSError setting keysize Key parameter error "%s" Writing private key to stdout '%s' encrypt_rsa_keyencrypt_key----- X509 requestissuer cert from -CA argpromptdistinguished_nameUnable to get '%s' section attributes_min_max_default_valueNameDN defaultDN valueAttribute defaultAttribute valueError adding attribute Old subject=New subject=Error getting public key Error printing certificate subject=Modulus is unavailable Modulus=Wrong Algorithm typedefault_keyfilekeygen_engineNew requestRequest template filereqoptVarious request text optionsText form of requestx509v1CAkey(Required by some CA's)set_serialSerial number to useAn alias for -extensionsaddextprecertKeys and Signing options: pubkeyOutput public keykeyoutFile to write private key toDo not output REQnewhdrRSA moduluspkcs1PrivateKeyInfoNot an RSA key RSA key ok RSA key not ok writing RSA key apps/rsa.cVerify key consistencyRSAPublicKey_inInput is an RSAPublicKeyOutput a public keyRSAPublicKey_outOutput is an RSAPublicKeyPrint the RSA key modulusPVK options: hold rsa keyoutput rsa keyRSA operation error apps/rsautl.cSign with private keyEncrypt with public keyDecrypt with private keyrawUse no paddingpkcsx931Use ANSI X9.31 paddingoaepUse PKCS#1 OAEPOCSP response: no response sent response parse error SERVERINFO FOR EXTENSION %dpsk_client_cb created identity '%s' len=%d apps/s_client.ccreated PSK len=%ld Error in PSK client callback hexdecode--- Reused, --- New, --- Certificate chain %2d s: i: v:NotBefore: ; NotAfter: --- Server certificate Server raw public key no peer rpk available --- SCTs present (%i) SCT validation status: %s --- %s, Cipher is %s Protocol: %s Server public key is %d bit Compression: %s Expansion: %s Next protocol: (%d) ALPN protocol: No ALPN negotiated Early data was not sent Early data was rejected Early data was accepted Verify return code: %ld (%s) Keying material exporter: Label: '%s' Length: %i bytes export key Error Keying material: Can't use SSL_get_servername mail.example.comclientnoreqlocalhost4433cbufsbufmbufverify depth is %d Error writing file %s Not a hex number '%s' %s: Can't use both -4 and -6 Error getting proxy password client certificateclient certificate chainError adding CRL Unable to create BIO Error setting verify params Error loading CA names Error setting SRTP profile Error parsing -alpn argument Error setting ALPN Can't open session file %s Can't set session Connecting via TFO connect:errno=%d CONNECTED(%08X) getsockname:errno=%d Failed to set MTU LHLO %s EHLO %s STARTTLSSTARTTLS STLS BIO_read failed . CAPABILITY . STARTTLS AUTH TLS %d Failed to initiate requestLOOKUP renego during write Write BLOCK (Async) Write BLOCK ERROR - memory ERROR - unable to connect LOOKUP during accept %s DELAY verify error:%s LOOKUP renego during read Read BLOCK (Async) Read BLOCK CONNECTION CLOSED shutting down SSL server www bufferGET GET /stats GET /renegcertSSL_renegotiate -> %d SSL_do_handshake() Retval %d
<>&%-11s:%-25s                           
GET /'%s' contains '..' or ':' '%s' is an invalid path '%s' is a directory FILE:%s .html.php.htmrwrite W BLOCK GET /renegserver rev bufferCONNECTION FAILURE LOOKUP renego during accept CLOSEcert_status: callback called cert_status: AIA URL: %s \x%02xHostname in TLS extension: "" Switching server context. psk_server_cb identity_len=%d identity=%s PSK client identity found fetched PSK len=%ld Error in PSK server callback ALPN protocols selected: Lookup session: cache hit Lookup session: cache miss get sessionError encoding session get session bufferserver2.pemserver.pemCan't use -rev with DTLS Can only use -tfo with TLS server certificateserver certificate chainsecond server certificateerror setting 'id_prefix' id_prefix '%s' set. DH parametersSetting temp DH parameters Compressing certificates Listening for TFO trace protocol messagesacceptunlinkcontextSet session ID contextnocertVerifycert2key2dcertdcertformdcert_chaindkeydkeyformdpassDH parameters file to useservername_fatalNo server outputno_resume_ephemeralwwwWWWHTTPid_prefixno_cacheDisable session cacheext_cacheDo not ignore input EOFOCSP options: status_verbosestatus_timeoutstatus_urlStatus request fallback URLstatus_filePrint more outputPrint the SSL statesOperate in asynchronous modenacceptEnable timeoutsSet link-layer MTUServer identity options: PSK identity to expectpsk_hintPSK identity hint to usesrpvfilesrpuserseedmax_early_datarecv_max_early_dataAttempt to read early datanum_ticketsanti_replayno_anti_replayhttp_server_binmodeno_ca_namesstatelessRequire TLSv1.3 cookiesJust talk TLSv1Just talk TLSv1.1just talk TLSv1.2just talk TLSv1.3Use any DTLS versionlistenJust talk DTLSv1Just talk DTLSv1.2no_dheDisable ephemeral DHlocalhost:4433%s: verify depth is %d %s: -www option is too long SSL_CIPHERUnable to get connection startingConnection options: Just time new connectionsreuseJust time connection reuseJust use TLSv1.0timecafileunable to load SSL_SESSION Context too long Error setting id context No certificate present unable to write SSL_SESSION unable to write X509 Set the session ID contextPrint ssl session id detailsOutput certificate Provider: %s Key management: %s (invalid operation)pk7outcertificatesError reading S/MIME message apps/smime.cAction options: Output PKCS#7 structureSigning/Encryption options: Signer certificate fileEmail options: Certificate chain options: nochainSM2 verify init failure SM2 verify failure SM2 init sign failure SM2 sign failure EdDSA verify init failure EdDSA verify failure EdDSA sign init failure EdDSA sign failure Failed to set iv length Failed to set tag length Failed to set key and iv Failed to encrypt the data sig sign loopSIG sign failure at count %d apps/speed.cError finalizing cipher loop Failed to set iv Failed to set tag Failed to decrypt the data +DT:%s:%d:%d +DTP:%d:%s:%s:%d +DTP:%s:%s:%d Doing %s %s ops for %ds: Failure in the job Failure in the select ECDSA verify failure ECDSA sign failure DSA verify failure DSA sign failure RSA decrypt failure RSA encrypt failure RSA verify failure RSA sign failure +R:%d:%s:%f %d %s ops in %.2fs %s error! ripemd160whirlpoolmdc2md2EC params init failure. EC key generation failure. priv+R1:%ld:%d:%.2f +R2:%ld:%d:%.2f +R3:%ld:%d:%.2f +R4:%ld:%d:%.2f +R5:%ld:%u:%.2f +R6:%ld:%u:%.2f +R7:%ld:%u:%.2f +R8:%ld:%u:%.2f +R9:%ld:%d:%.2f +R10:%ld:%u:%s:%.2f +R11:%ld:%u:%s:%.2f +R12:%ld:%u:%s:%.2f +R13:%ld:%u:%s:%.2f +R14:%ld:%d:%.2f +R15:%ld:%s:%.2f +R16:%ld:%s:%.2f +R17:%ld:%s:%.2f +R18:%ld:%s:%.2f +R19:%ld:%s:%.2f +R20:%ld:%s:%.2f %11.2f :%.2f%s: %s is an unknown digest %s: %s is an unknown cipher %s: multi argument too large %s: too many async_jobs %s: Maximum offset is %d ECP-256ECP-384ECP-521dsa1024dsa2048ED25519ED448ECDSASIPHASHPOLY1305CMACopensslrsa512rsa1024rsa2048rsa3072rsa4096rsa7680rsa15360ffdhffdh2048ffdh3072ffdh4096ffdh6144ffdh8192camelliaecdsaecdheddsaed25519ed448kmaccmac%s: Unknown algorithm %s %s is not an AEAD cipher array of loopargsError: buffer size too large input bufferECDH secret aECDH secret bFFDH secret aFFDH secret bfd buffer for do_multipipe failure Forked child %d dup failed fdopen failure with 0x%x Got: %s from %d +F:+F2:+F3:+F4:+F5:+F6:+F7:+F8:+F9:+F10:+H:Child exited with %d GMACHMAC namehmac(%s) Invalid cipher! aes-128-gcmmultiblock input buffermultiblock output bufferevp_cipher keyfailed to set cipher key failed to set AEAD key failed to get cipher name error setting random bytes evpError performing cipher op +H:%d+F:%d:%stype %7d bytes%-24s %11.2fk EVP_CIPHER_CTX_new failure Couldn't init the context Failed to set the key Failed to get the tag CMAC namecmac(%s)KMAC-128KMAC-256ECDH key generation failure. ECDH computation failure. EdDSA failure. TLSv1.3+GM+Cipher+SuiteSM2 init failure. FFDH key generation failure. FFDH computation failure. rsa%u%sX25519X448RSASVEDHKEMencaps resultencaps secretEncaps error for %s. KEM decaps secretDecaps error for %s. keygenencapsdecapsSigning error for %s. Verify error for %s. Verify 2 error for %s. signsversion: %s options: %s type +F:%u:%s%-13s+F2:%u:%u:%f:%f:%f:%f +F3:%u:%u:%f:%f +F4:%u:%u:%f:%f %30sop op/s +F5:%u:%u:%f:%f +F6:%u:%u:%s:%f:%f CurveSM2+F7:%u:%u:%s:%f:%f %23sop op/s +F8:%u:%u:%f:%f %4u bits ffdh %8.4fs %8.1f +F9:%u:%f:%f:%f +F10:%u:%f:%f:%f curveSM2rsa decryptrsa encryptrsa verifyrsa signsecp160r1nistp192nistp224nistp256nistp384nistp521nistk163nistk233nistk283nistk409nistk571nistb163nistb233nistb283nistb409nistb571brainpoolP256r1brainpoolP256t1brainpoolP384r1brainpoolP384t1brainpoolP512r1brainpoolP512t1Ed25519Ed448ecdhp160ecdhp192ecdhp224ecdhp256ecdhp384ecdhp521ecdhk163ecdhk233ecdhk283ecdhk409ecdhk571ecdhb163ecdhb233ecdhb283ecdhb409ecdhb571ecdhbrp256r1ecdhbrp256t1ecdhbrp384r1ecdhbrp384t1ecdhbrp512r1ecdhbrp512t1ecdhx25519ecdhx448ecdsap160ecdsap192ecdsap224ecdsap256ecdsap384ecdsap521ecdsak163ecdsak233ecdsak283ecdsak409ecdsak571ecdsab163ecdsab233ecdsab283ecdsab409ecdsab571ecdsabrp256r1ecdsabrp256t1ecdsabrp384r1ecdsabrp384t1ecdsabrp512r1ecdsabrp512t1ripemdrc5-cbcrc5idea-cbcideablowfishcast5ghashkmac128kmac256hmac(sha256)mbmrRun benchmarks in parallelasync_jobsmlocktestmodeSelection options: HMAC using EVP-named digestCMAC using EVP-named cipheraeadBenchmark KEM algorithmsTiming options: elapsedsecondsbytesmisalignMD5Error setting public key Error signing SPKAC apps/spkac.cSPKAC=%s Can't find SPKAC called "%s" Error loading SPKAC Signature OK Signature Failure spksectchallengeChallenge stringAlternative SPKAC nameDon't print SPKACVerify SPKAC signaturePass %s apps/srp.cUser entry%s "%s" %d = "%s" g N entryNeed at least one user. default_srpDatabase initialised Default g and NStarting user processing Processing user "%s" List all users user "%s" reactivated. row pointersfailed to update srpvfile Password for user "%s" ok. user "%s" revoked. t User procession done. Temporary srpvfile created. srpvfile updated. User errors %d. Trying to update srpvfile. Talk a lot while doing thingsaddAdd a user and SRP verifiermodifydeleteList usersThe srp verifier file namegnuserinfouser%*sCouldn't open file or uri %s %d: %s: %s %d: %s !!! Unknown code Total found: %d %s: criterion already given. %s: subject already given. %s: issuer already given. %s: alias already given. apps/storeutl.cURIUsage: %s [options] uri Search options: certsSearch for certificates onlykeysSearch for keys onlycrlsSearch for CRLs onlySearch by subjectaliasSearch by aliasRecurse through namesNo PEM output, just statusuriURI of the store objectdigest bufferapps/ts.cError getting password. Using configuration from %s cannot convert %s to OID nonce buffercould not create nonce Verification: invalid digest string Error loading directory %s Error loading file %s Error loading store URI %s extra untrusted certsFAILEDcould not create query Response is not generated. Response has been generated. Typical uses: [-text] [-engine id]Configuration fileFile with signer CA chainFile with trusted CA certsPath to trusted CA filesURI to trusted CA storeExtra untrusted certstoken_inInput is a PKCS#7 filetoken_outOutput is a PKCS#7 fileQuery options: queryGenerate a TS queryFile to hashDigest (as a hex string)queryfileFile containing a TS queryPut cert request into queryVerify options: Verify a TS responsereplyGenerate a TS replytspolicyPolicy OID to useDo not include a nonceOutput text (not DER)[CRL path] %s: OK Chain: depth=%d: (untrusted) %-15s %s trusted certificatesother CRLsCRLfileshow_chainN/AOpenSSL 3.5.5 27 Jan 2026%s (Library: %s) options: %sOPENSSLDIR: %s ENGINESDIR: %s MODULESDIR: %s Seeding source: %s Show all databShow build dateShow configuration directoryShow engines directorymShow modules directoryfShow compiler flags usedoShow target build platformShow random seeding optionsShow library versionShow CPU settings infoInvalid date format: %s explicitly set public keycertificate request inputserial# bufferapps/x509.cSHA1serial= Certificate purposes: %s%s : Yes (WARNING code=%d) No Yes CAnotBefore=notAfter=Unknown digest No extensions in certificate Invalid extension names: %s Certificate will expire Certificate will not expire Unable to write certificate x509toreqSame as -keycertoptPrint certificate aliasPrint serial number valuePrint the notBefore fieldPrint the notAfter fielddatesPrint subject DNemailPrint email address(es)subject_hashPrint subject hash valuesubject_hash_oldissuer_hashPrint issuer hash valueissuer_hash_oldextocspidocsp_uriPrint OCSP Responder URL(s)checkendcheckhostcheckemailcheckipCertificate output options: next_serialpreserve_datesset_issuerset_subjectAlias for -set_subjectforce_pubkeyclrextMicro-CA options: CAformCAkeyformCAserialCAcreateserialtrustoutsetaliasclrtrustClear all trusted purposesaddtrustclrrejectaddrejectnulloctet stringpointer to an unknown typeUTF8 encoded stringintegerunsigned pointer to a %*sEmpty list of %s (!!!) %*s%s: %s%s [%d] (arbitrary size) (max %zu bytes large)%*s %s %*s%s: %llu error getting value %lld <%zu bytes> apps/lib/app_provider.cRANDFILECan't load %s into RNG apps/lib/app_rand.cCan't duplicate %s Cannot write random bytes: apps/lib/app_x509.cdistidhexdistiderror: allocation failed %s: Can't load %s: Error on line %ld of config file "%s" config inputoid_sectionapps/lib/apps.crfc_822iso_8601copycopyall 0x000x%02X,0x%02X }; unsigned char %s[%d] = { }; 0x%02X, File name too long %s.%sUnable to rename %s to %s reasonyesno%s.attr%s.attr.%sUnable to open '%s' unique_subject = %s %s: Out of memory TrueFalseRequire explicit Policy: %s Authority%s Policies: UserNPN buffer NOTsubjectKeyIdentifierkeyid, issuerauthorityKeyIdentifiermissing SSL_CTXHARNESS_OSSL_PREFIXCan't open %s, %s readingCan't open "%s" for %s, %s No configuration used calling fstat(%s)new DBpass:env:No environment variable %s file:fd:Can't open file %s Can't open BIO for stdin key parametersCRLsOut of memory loadinginput-typeInternal error trying to loadError readingCould not find from %s: %s of %shttps://http://Unable to load %s from %s CRL via CDPhas expirednot yet validis not a CA certstdoutappending(doing something)abUnable to load %s Error reading mem buffer allocate async fdstodaystart dateend dateWarningErrorParameter %s '%s' asymmetricGenerating %s key with %d bits %s: Error generating %s key esc_2253esc_2254esc_ctrlesc_msbuse_quoteignore_typeshow_typedump_alldump_nostrdump_dersep_comma_plussep_comma_plus_spacesep_semi_plus_spacesep_multilinedn_revnofnamesnamelnamealignspace_eqdump_unknownRFC2253onelinemultilineca_defaultcompatibleno_headerno_versionno_serialno_signameno_validityno_subjectno_issuerno_pubkeyno_extensionsno_sigdumpno_auxno_attributesext_defaultext_errorext_parseext_dumppass phraseapps/lib/apps_ui.cUser interface error aborted! autoEnabling auto ENGINE support dynamicSO_PATHLOADInvalid engine "%s" SET_USER_INTERFACECannot use engine "%s" Engine "%s" set. apps/lib/engine.corg.openssl.engine:apps/lib/engine_loader.corg.openssl.engineapps/lib/http_server.c (core dumped)child PID arraywaitpid() failed: %sRAND_poll() failedterminating on signal: %d*:%serror setting up accept BIOerror printing ACCEPT stringConnection: keep-alive sending response header: %s%s HTTP/1.0 %d %s GET or cannot get port listening onawaiting next request ...request line read errorBad Request HTTP/1.error reading HTTP headerConnectionkeep-aliveclosePOST received request header:Invalid verbosity level %d{ }parmvaldirinfileoutfile+intlongulongPEM|DER|ENGINEPEM|DERformatintmaxnonneguintmax%s: Bad format "%s" BASE64PKCS12(undefined)TEXTNSSENGINEP12%s XTS ciphers not supported %s: Value must be one of: %s a hexadecimal0Xan octalapps/lib/opt.cassertion failed: vpm != NULL%s: Invalid Policy %s %s: Invalid purpose %s %s: Invalid verify name %s %s: Missing argument: %s %s: Extra option: "%s" (No additional info)-*Usage: %s [options] Valid options are: Parameters: %s %s %s: Option -%s needs a value %s: Not a directory: %s %s: Unknown option: -%s derb64msblobnsshttppvk???Security callback: Version=%s%s=Public key missing%s, bits=%d digest=%s, algorithm=%s scheme=unknown(0x%04x), security bits=%d: %s scheme=%sOK NOT OK %s: %s NOT OK Suite B: not tested gost2012_256gost2012_512gost2001Shared Requested Signature Algorithms: rsa_pss_pss_sha256rsa_pss_pss_sha384rsa_pss_pss_sha512ecdsa_brainpoolP256r1_sha256ecdsa_brainpoolP384r1_sha384ecdsa_brainpoolP512r1_sha512+%s+0x%02Xdepth=%d verify error:num=%d:%s issuer= verify return:%d error setting certificate error setting private key Client Certificate Types: UNKNOWN (%d),Peer signing digest: %s Peer signature type: %s ansiX962_compressed_primeansiX962_compressed_char2unknown(%d)groups to printSupported groups: apps/lib/s_cb.c Shared groups: ?Negotiated TLS1.3 group: %s Peer Temp Key: RSA, %d bits DH, %d bits ECDH, %s, %d bits %s, %d bits SSL_connectSSL_acceptundefinedreadwrite%s:%s SSL3 alert %s:%s:%s %s:failed in %s %s:error in %s >>><<<, fatal, ???, warning, ChangeCipherSpec, InnerContent, ApplicationData, RecordHeader, Alert, Handshake ???, Unknown (content_type=%d)%s %s%s [length %04lx]%s%s %02x server namememory full Failed getting peer address assertion failed: length != 0cookie generate bufferMissing filename Server Certificateserver keyserver chainprepend cert%s: Key already specified %s: Chain already specified ...matched the TAsigned the peermatched the EEVerification: OK Verified peername: %s Verification error: %s TLSA hex data buffer0123456789abcdefDANE TLSA %d %d %d %s%s %s certificate at depth %d Protocol version: %s assertion failed: num == 2Client cipher list: SCSVCiphersuite: %s Peer certificate: Hash used: %s Signature type: %s Peer used raw public key Error finishing context Error writing keylog file %s Supported CiphersuiteShared CiphersuiteCheck CiphersuiteTemp DH key bitsSupported CurveShared CurveCheck CurveSupported Signature AlgorithmShared Signature AlgorithmCheck Signature AlgorithmSignature Algorithm maskCertificate chain EE keyCertificate chain CA keyPeer Chain EE keyPeer Chain CA keyCertificate chain CA digestPeer chain CA digestSSL compressionSession ticketOverall ValiditySign with EE keyEE signatureCA signatureEE key parametersCA key parametersExplicitly sign with EE keyIssuer NameCertificate TypeSHA224SHA384SHA512anonymousrsa_pkcs1_sha1ecdsa_sha1rsa_pkcs1_sha256ecdsa_secp256r1_sha256rsa_pkcs1_sha384ecdsa_secp384r1_sha384rsa_pkcs1_sha512ecdsa_secp521r1_sha512rsa_pss_rsae_sha256rsa_pss_rsae_sha384rsa_pss_rsae_sha512gostr34102001gostr34102012_256gostr34102012_512max fragment lengthclient certificate URLtrusted CA keystruncated HMACstatus requestuser mappingclient authzserver authzcert typesupported_groupsEC point formatsSRPsignature algorithmsuse SRTPsession ticketrenegotiation infosigned certificate timestampsclient cert typeserver cert typeTLS paddingnext protocolencrypt-then-macextended master secretcompress certificatekey sharesupported versionspsk kex modescertificate authoritiespost handshake auth, HelloRequest, ClientHello, ServerHello, HelloVerifyRequest, NewSessionTicket, EndOfEarlyData, EncryptedExtensions, Certificate, ServerKeyExchange, CertificateRequest, ServerHelloDone, CertificateVerify, ClientKeyExchange, Finished, CertificateUrl, CertificateStatus, SupplementalData, KeyUpdate, CompressedCertificate, NextProto, MessageHash close_notify end_of_early_data unexpected_message bad_record_mac decryption_failed record_overflow decompression_failure handshake_failure bad_certificate unsupported_certificate certificate_revoked certificate_expired certificate_unknown illegal_parameter unknown_ca access_denied decode_error decrypt_error export_restriction protocol_version insufficient_security internal_error inappropriate_fallback user_canceled no_renegotiation missing_extension unsupported_extension certificate_unobtainable unrecognized_name bad_certificate_hash_value unknown_psk_identity certificate_requiredSSL 3.0TLS 1.0TLS 1.1TLS 1.2TLS 1.3DTLS 1.0DTLS 1.0 (bad)RSA signDSA signRSA fixed DHDSS fixed DHECDSA signRSA fixed ECDHECDSA fixed ECDHGOST01 SignGOST12 Signunix IPv6 IPv4 apps/lib/s_socket.cInternal error Connecting to %s %s:%s [%s]:%sACCEPTunknown:error PID=%dSRP parameters: N= g=SRP param N and g rejected. SRP password bufferSRP userapps/lib/tlssrp_depr.cSRP username = "%s" User %s doesn't exist Unable to set SRP username LOOKUP done %s LOOKUP not successful process_cert_requestprocess_rrcheck_client_crlprocess_genmprocess_errorprocess_certConfprocess_pollReqdelayed_deliveryclean_transactionossl_cmp_mock_srv_set_checkAfterTimeossl_cmp_mock_srv_set_pollCountossl_cmp_mock_srv_set_sendErrorossl_cmp_mock_srv_set_statusInfoossl_cmp_mock_srv_set1_oldWithNewossl_cmp_mock_srv_set1_newWithOldossl_cmp_mock_srv_set1_newWithNewossl_cmp_mock_srv_set1_caPubsOutossl_cmp_mock_srv_set1_chainOutossl_cmp_mock_srv_set1_crlOutossl_cmp_mock_srv_set1_keyOutossl_cmp_mock_srv_set1_certOutossl_cmp_mock_srv_set1_refCert%s: Memory allocation failure input format - one of DER PEM B64output file (output format is always DER)offset; a series of these can be used to 'dig'into multiple ASN1 blob wrappingsstring to generate ASN1 structure fromfile to generate ASN1 structure fromequivalent to '-inform pem' (obsolete)dump the first arg bytes of unknown data in hex formAdding Entry with serial number %s to DB for %s ERROR:Already present, serial number %s ERROR:Already revoked, serial number %s Invalid time format %s. Need YYYYMMDDHHMMSSZ Error in revocation arguments variable lookup failed for %s::%s invalid type, Database error The Subject's Distinguished Name is as follows emailAddress type needs to be of type IA5STRING The string contains characters that are illegal for the ASN.1 type %s:unknown object type in 'policy' configuration The %s field needed to be supplied and was missing The mandatory %s field was missing The %s field does not exist in the CA certificate, the 'policy' is misconfigured The %s field is different between CA certificate (%s) and the request (%s) %s:invalid type in 'policy' configuration Everything appears to be ok, creating and signing the certificate Warning: Signature key and public key of cert do not match Extra configuration file found Error adding certificate extensions from extfile section %s Successfully added extensions from file. Error adding certificate extensions from config section %s Successfully added extensions from config ERROR: adding extensions from request The subject name appears to be ok, checking database for clashes ERROR:There is already a certificate for %s ERROR:Serial number %s has already been issued, check the database/serial_file for corruption Certificate is to be certified until CERTIFICATE WILL NOT BE CERTIFIED: I/O error CERTIFICATE WILL NOT BE CERTIFIED The matching entry has the following details Check that the request matches the signature Certificate request and CA private key do not match Signature verification problems... Signature did not match the certificate request Invalid global string mask setting %s Problem with index file: %s (could not load/parse file) CA certificate and CA private key do not match Invalid certificate options: "%s" Invalid extension copy option: "%s" there needs to be defined a directory for new certificate to be placed in entry %d: not revoked yet, but has a revocation date entry %d: invalid expiry date entry %d: bad serial number length (%d) entry %d: bad char 0%o '%c' in serial number %d entries loaded from the database No entries found to mark expired Done. %d entries marked as expired Successfully loaded extensions file %s Error checking certificate extensions from extfile section %s Error checking certificate extension config section %s cannot lookup how many days to certify for Warning: -enddate or -not_after option overriding -days option error generating serial number error while loading serial number unable to find 'section' for %s no name/value pairs found in %s unable to load Netscape SPKAC structure Netscape SPKAC structure not found in %s Check that the SPKAC request matches the signature error unpacking SPKAC public key signature verification failed on SPKAC public key Signature verification problems.... Signature did not match the certificate %d out of %d certificate requests certified, commit? [y/n]CERTIFICATION CANCELED: I/O error Write out database with %d new entries certificate file name too long Error checking CRL extension section %s error while loading CRL number cannot lookup how long until the next CRL is issued Error adding CRL extensions from section %s Usage: %s [options] [certreq...] Verbose output during processingTerse output during processingCSR input format to use (PEM or DER; by default try PEM first)The last argument, requests to processWhere to put the output file(s)Datetime format used for printing. (rfc_822/iso_8601). Default is rfc_822.Do not print the generated certificatemsie modifications to handle all Universal StringsFile contains a self signed cert to signFile contains DN and signed public key and challengeUse engine, possibly a hardware deviceThe particular CA definition to useUse arg instead of request's subjectInput characters are UTF8; default ASCIIIf reading serial fails, create a new random serialAlways create a random serial; do not store itDeprecated; multi-valued RDNs support is always on.[CC]YYMMDDHHMMSSZ value for notBefore certificate field[CC]YYMMDDHHMMSSZ value for notAfter certificate field, overrides -daysNumber of days from today to certify the cert forExtension section (override value in config file)Configuration file with X509v3 extensions to addDon't add the EMAIL field to the DNPrivate key file format (ENGINE, other values ignored)Key and cert input file pass phrase sourceKey to decrypt the private key or cert files if encrypted. Better use -passinCertificate input format (DER/PEM/P12); has no effectSign a cert with the key associated with itSignature parameter in n:v formVerification parameter in n:v formAdd a Valid(not-revoked) DB entry about a cert (given in file)Shows cert status given the serial numberCRL extension section (override value in config file)the hold instruction, an OID. Sets revocation reason to certificateHoldsets compromise time to val and the revocation reason to keyCompromisesets compromise time to val and the revocation reason to CACompromiseSets the CRL lastUpdate time to val (YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ)Sets the CRL nextUpdate time to val (YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ)Days until the next CRL is dueHours until the next CRL is dueSeconds until the next CRL is dueLoad the given file(s) into the random number generatorWrite random data to the specified fileProvider load path (must be before 'provider' argument if required)Provider to load (can be specified multiple times)Set a provider key-value parameterProperty query used when fetching algorithmsCertificate requests to be signed (optional)Error setting TLSv1.3 ciphersuites 0x%02X,0x%02X,0x%02X,0x%02X - Verbose listing of the SSL/TLS ciphersConvert standard name into OpenSSL nameCipher specification options: Ciphers compatible with TLS1.1Ciphers compatible with TLS1.2Ciphers compatible with TLS1.3Include ciphersuites requiring PSK(deprecated) Include ciphersuites requiring SRPConfigure the TLSv1.3 ciphersuites to useCipher string to decode (optional)error setting verification parameters for %s %s:%s:%d:CMP %s: not enough file names provided for reading PKIMessage%s%s%s %s:%s:%d:CMP %s: cannot read PKIMessage from file '%s'%s%s %s:%s:%d:CMP %s: received %d %s certificate(s), saving to file '%s' %s:%s:%d:CMP %s: saving more than one certificate in non-PEM format%s%s%s %s:%s:%d:CMP %s: could not open file '%s' for %s %s certificate(s) error: unsupported type '%s' for writing certificates %s:%s:%d:CMP %s: cannot write %s certificate to file '%s'%s %s:%s:%d:CMP %s: using only first %d characters of section name starting with "%.*s" %s:%s:%d:CMP %s: %s option argument is empty string, resetting option%s%s %s:%s:%d:CMP %s: %s option argument starts with hyphen%s%s %s:%s:%d:CMP %s: NULL arg to write_PKIMESSAGE%s%s%s %s:%s:%d:CMP %s: not enough file names provided for writing PKIMessage%s%s%s %s:%s:%d:CMP %s: cannot write PKIMessage to file '%s'%s%s %s:%s:%d:CMP %s: cannot write request PKIMessage to file '%s'%s%s %s:%s:%d:CMP %s: too few -rspin filename arguments; resorting to using mock server%s%s%s %s:%s:%d:CMP %s: missing -server or -use_mock_srv option, or too few -rspin filename arguments%s%s%s %s:%s:%d:CMP %s: too few -rspin filename arguments; resorting to contacting server%s%s%s %s:%s:%d:CMP %s: Failed to delete %s, which should be done to indicate there is no %s%s %s:%s:%d:CMP %s: Logging verbosity level %d out of range (0 .. 8)%s%s %s:%s:%d:CMP %s: -keep_alive argument must be 0, 1, or 2%s%s%s %s:%s:%d:CMP %s: invalid popo spec. Valid values are -1 .. 2%s%s%s %s:%s:%d:CMP %s: invalid revreason. Valid values are -1 .. 6, 8 .. 10%s%s%s %s:%s:%d:CMP %s: must give -srv_ref for mock server if no -srv_cert given%s%s%s %s:%s:%d:CMP %s: server credentials (-srv_secret or -srv_cert) must be given if -use_mock_srv or -port is used%s%s%s %s:%s:%d:CMP %s: server will not be able to handle PBM-protected requests since -srv_secret is not given%s%s%s %s:%s:%d:CMP %s: must give both -srv_cert and -srv_key options or neither%s%s%s signer certificate of the mock serverprivate key for mock server cert%s:%s:%d:CMP %s: mock server will not be able to handle signature-protected requests since -srv_trusted is not given%s%s%s untrusted certificates for mock serverreference cert to be expected by the mock server%s:%s:%d:CMP %s: no -rsp_cert given for mock server%s%s%s cert the mock server returns on certificate requestsprivate key for enrollment certCRL to be returned by the mock serverCMP extra certificates for mock serverNewWithNew cert the mock server returns in rootCaKeyUpdateNewWithOld cert the mock server returns in rootCaKeyUpdateOldWithNew cert the mock server returns in rootCaKeyUpdate%s:%s:%d:CMP %s: -failure out of range, should be >= 0 and <= %d%s%s %s:%s:%d:CMP %s: -failurebits overrides -failure%s%s%s %s:%s:%d:CMP %s: -failurebits out of range%s%s%s , and -key option superseded by -csrfallback public key for cert to be enrolledpublic key for checking cert resulting from p10crreference certificate (oldcert)%s:%s:%d:CMP %s: no -subject given; no -csr or -oldcert or -cert available for fallback%s%s%s %s:%s:%d:CMP %s: out of memory%s%s%s %s:%s:%d:CMP %s: missing -newkey (or -key) to be certified and no -csr, -oldcert, -cert, or -reqin option given, which could provide fallback public key. Neither central key generation is requested.%s%s%s %s:%s:%d:CMP %s: POPO is disabled, which implies -centralkeygen%s%s%s %s:%s:%d:CMP %s: -popo value %d is inconsistent with -centralkeygen%s%s %s:%s:%d:CMP %s: -newkeyout not given, nowhere to save centrally generated key%s%s%s %s:%s:%d:CMP %s: no -newkey option given with private key for POPO, -csr option provides just public key%s%s%s %s:%s:%d:CMP %s: since -reqin is used, may use -popo -1 or -popo 0 to disable the needless generation of a POPO%s%s%s %s:%s:%d:CMP %s: missing -newkey (or -key) option for key to be certified and for POPO%s%s%s %s:%s:%d:CMP %s: -certout not given, nowhere to save newly enrolled certificate%s%s%s %s:%s:%d:CMP %s: -subject %s since sender is taken from -ref or -cert%s%s option is ignored for commands other than 'ir', 'cr', and 'kur'%s:%s:%d:CMP %s: -issuer %s and 'rr'%s%s %s:%s:%d:CMP %s: -reqexts %s%s%s %s:%s:%d:CMP %s: -san_nodefault %s%s%s %s:%s:%d:CMP %s: -sans %s%s%s %s:%s:%d:CMP %s: -policies %s%s%s %s:%s:%d:CMP %s: -policy_oids %s%s%s %s:%s:%d:CMP %s: -popo %s%s%s %s:%s:%d:CMP %s: -popo -1 or -centralkeygen %s%s%s %s:%s:%d:CMP %s: -newkeyout %s%s%s %s:%s:%d:CMP %s: -implicit_confirm %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -disable_confirm %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -certout %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -chainout %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: missing -oldcert for certificate to be updated and no -csr given%s%s%s %s:%s:%d:CMP %s: given -subject '%s' overrides the subject of '%s' for KUR%s %s:%s:%d:CMP %s: missing -oldcert or -issuer and -serial for certificate to be revoked and no -csr given%s%s%s %s:%s:%d:CMP %s: ignoring -csr since certificate to be revoked is given%s%s%s %s:%s:%d:CMP %s: Must give both -issuer and -serial options or neither%s%s%s %s:%s:%d:CMP %s: Ignoring -oldcert since -issuer and -serial is given for command 'rr'%s%s%s %s:%s:%d:CMP %s: Ignoring -csr since -issuer and -serial is given for command 'rr'%s%s%s %s:%s:%d:CMP %s: cannot read serial number: '%s'%s%s %s:%s:%d:CMP %s: Ignoring -serial for command other than 'rr'%s%s%s %s:%s:%d:CMP %s: missing PKCS#10 CSR for p10cr%s%s%s %s:%s:%d:CMP %s: missing -recipient, -srvcert, -issuer, -oldcert or -cert; recipient for any requests not covered by -reqin will be set to "NULL-DN"%s%s%s %s:%s:%d:CMP %s: -newkeypass %s%s%s option is ignored for 'p10cr', 'rr', and 'genm' commands%s:%s:%d:CMP %s: -newkey %s%s%s %s:%s:%d:CMP %s: -days %s%s%s %s:%s:%d:CMP %s: -out_trusted %s%s%s new private key for cert to be enrolled%s:%s:%d:CMP %s: failed to load ir/cr/kur file '%s' attempting to get fallback public key%s%s %s:%s:%d:CMP %s: failed to get fallback public key from ir/cr/kur file '%s'%s%s %s:%s:%d:CMP %s: failed to get fallback public key obtained from ir/cr/kur file '%s'%s%s %s:%s:%d:CMP %s: could not set requested cert validity period%s%s%s %s:%s:%d:CMP %s: cannot have policies both via -policies and via -policy_oids%s%s%s %s:%s:%d:CMP %s: -csr option is ignored for 'genm' command%s%s%s %s:%s:%d:CMP %s: cannot load certificate request extension section '%s'%s%s %s:%s:%d:CMP %s: cannot load policy cert request extension section '%s'%s%s %s:%s:%d:CMP %s: cannot have Subject Alternative Names both via -reqexts and via -sans%s%s%s %s:%s:%d:CMP %s: bad syntax of %s '%s'%s %s:%s:%d:CMP %s: -opt_san_nodefault has no effect when -sans is used%s%s%s %s:%s:%d:CMP %s: -opt_policy_oids_critical has no effect unless -policy_oids is given%s%s%s %s:%s:%d:CMP %s: Invalid -policy_oids arg '%s'%s%s %s:%s:%d:CMP %s: Unknown -policy_oids arg: %.40s%s%s %s:%s:%d:CMP %s: cannot add policy with OID '%s'%s%s %s:%s:%d:CMP %s: -oldcert option is ignored for 'genm' command%s%s%s only if -rspin argument gives too few filenames%s:%s:%d:CMP %s: missing -server or -use_mock_srv or -rspin option%s%s%s %s:%s:%d:CMP %s: ignoring -proxy option since -server is not given%s%s%s %s:%s:%d:CMP %s: ignoring -no_proxy option since -server is not given%s%s%s %s:%s:%d:CMP %s: cannot parse -server URL: %s%s%s %s:%s:%d:CMP %s: assuming -tls_used since -server URL indicates HTTPS%s%s%s %s:%s:%d:CMP %s: unknown cmp command '%s'%s%s %s:%s:%d:CMP %s: no cmp command to execute%s%s%s %s:%s:%d:CMP %s: unknown option given for key loading format%s%s%s %s:%s:%d:CMP %s: unknown option given for certificate storing format%s%s%s %s:%s:%d:CMP %s: unknown option given for CRL storing format%s%s%s %s:%s:%d:CMP %s: no -infotype option given for genm%s%s%s %s:%s:%d:CMP %s: -infotype option is ignored for commands other than 'genm'%s%s%s %s:%s:%d:CMP %s: unknown OID name in -infotype option%s%s%s %s:%s:%d:CMP %s: -oldwithold %s%s%s option is ignored unless -cmd 'genm' and -infotype rootCaCert is given%s:%s:%d:CMP %s: -newwithnew %s%s%s %s:%s:%d:CMP %s: -newwithold %s%s%s %s:%s:%d:CMP %s: -oldwithnew %s%s%s %s:%s:%d:CMP %s: -template %s%s%s option is ignored unless -cmd 'genm' and -infotype 'certReqTemplate' is given%s:%s:%d:CMP %s: -keyspec %s%s%s %s:%s:%d:CMP %s: missing -template option for genm with infotype certReqTemplate%s%s%s %s:%s:%d:CMP %s: -trusted option is ignored since -srvcert option is present%s%s%s %s:%s:%d:CMP %s: -recipient option is ignored since -srvcert option is present%s%s%s directly trusted CMP server certificatetrusted certs for verifying newly enrolled cert%s:%s:%d:CMP %s: -total_timeout argument = %d must not be < %d (-msg_timeout)%s %s:%s:%d:CMP %s: -reqin is ignored since -rspin is present%s%s%s %s:%s:%d:CMP %s: -reqin_new_tid is ignored since -reqin is not present%s%s%s %s:%s:%d:CMP %s: missing -tls_key option%s%s%s %s:%s:%d:CMP %s: missing -tls_cert option%s%s%s %s:%s:%d:CMP %s: -tls_used given without -tls_trusted; will not authenticate the TLS server%s%s%s TLS client certificate (optionally with chain)%s:%s:%d:CMP %s: unable to use client TLS certificate file '%s'%s%s %s:%s:%d:CMP %s: could not add untrusted cert to TLS client cert chain%s%s%s %s:%s:%d:CMP %s: trying to build cert chain for own TLS cert%s%s%s %s:%s:%d:CMP %s: success building cert chain for own TLS cert%s%s%s %s:%s:%d:CMP %s: could not build cert chain for own TLS cert%s%s%s error: unable to add TLS extra certs %s:%s:%d:CMP %s: TLS private key '%s' does not match the TLS certificate '%s' %s %s:%s:%d:CMP %s: unable to use TLS client private key '%s'%s%s %s:%s:%d:CMP %s: -tls_used given without -tls_key; cannot authenticate to the TLS server%s%s%s %s:%s:%d:CMP %s: must give -key or -secret unless -unprotected_requests is used%s%s%s %s:%s:%d:CMP %s: must give -ref if no -cert and no -subject given%s%s%s %s:%s:%d:CMP %s: must give both -cert and -key options or neither%s%s%s %s:%s:%d:CMP %s: -cert and -key not used for protection since -secret is given%s%s%s private key for CMP client certificate%s:%s:%d:CMP %s: will not authenticate server due to missing -secret, -trusted, or -srvcert%s%s%s CMP client certificate (optionally with chain)trusted certs for verifying own CMP signer cert%s:%s:%d:CMP %s: -own_trusted option is ignored without -cert%s%s%s %s:%s:%d:CMP %s: digest algorithm name not recognized: '%s'%s%s %s:%s:%d:CMP %s: digest algorithm name not supported: '%s'%s%s %s:%s:%d:CMP %s: MAC algorithm name not recognized: '%s'%s%s %s:%s:%d:CMP %s: Missing ':' in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Invalid OID in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Unknown OID in -geninfo arg: %.40s%s%s %s:%s:%d:CMP %s: Cannot parse int in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Missing ',' or end of -geninfo arg after int at %.40s%s%s %s:%s:%d:CMP %s: Missing 'int:' or 'str:' in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Unable to create 'OSSL_CMP_ITAV' structure%s%s%s %s:%s:%d:CMP %s: Failed to add ITAV for geninfo of the PKI message header%s%s%s %s:%s:%d:CMP %s: will contact %s%s%s %s:%s:%d:CMP %s: using section(s) '%s' of OpenSSL configuration file '%s'%s %s:%s:%d:CMP %s: no [%s] section found in config file '%s'; will thus use just [default] and unnamed section if present%s %s:%s:%d:CMP %s: no [%s] section found in config file '%s'%s assertion failed: OSSL_NELEM(cmp_vars) == n_options + OPT_PROV__FIRST + 1 - OPT_PROV__LAST + OPT_R__FIRST + 1 - OPT_R__LAST + OPT_V__FIRST + 1 - OPT_V__LASTNon-positive number "%ld" for config option -%s Negative number "%ld" for config option -%s %s:%s:%d:CMP %s: internal: unsupported type '%c' for option '%s'%s %s:%s:%d:CMP %s: for option '%s' in config file section '%s'%s integer value out of range for option '%s' %s:%s:%d:CMP %s: cannot load engine %s%s%s %s:%s:%d:CMP %s: cannot set up error reporting and logging for %s%s%s %s:%s:%d:CMP %s: -tls_used given without any other TLS options%s%s%s %s:%s:%d:CMP %s: ignoring TLS options(s) since -tls_used is not given%s%s%s %s:%s:%d:CMP %s: -tls_used option not supported with -port option%s%s%s %s:%s:%d:CMP %s: The -port option excludes -server and -use_mock_srv%s%s%s %s:%s:%d:CMP %s: The -port option does not support -reqin and -reqout%s%s%s %s:%s:%d:CMP %s: The -port option does not support -rspin and -rspout%s%s%s %s:%s:%d:CMP %s: cannot use both -server and -use_mock_srv options%s%s%s %s:%s:%d:CMP %s: ignoring -tls_used option since -server is not given or -use_mock_srv is given%s%s%s %s:%s:%d:CMP %s: expecting empty path or 'pkix/' but got '%s'%s%s %s:%s:%d:CMP %s: the -reqout_only client option does not combine with -port implying server behavior%s%s%s %s:%s:%d:CMP %s: -server %s%s%s option is ignored since -reqout_only option is given%s:%s:%d:CMP %s: -use_mock_srv %s%s%s %s:%s:%d:CMP %s: -reqout %s%s%s %s:%s:%d:CMP %s: -rspin %s%s%s %s:%s:%d:CMP %s: -rspout %s%s%s %s:%s:%d:CMP %s: -server option is not used if enough filenames given for -rspin%s%s%s %s:%s:%d:CMP %s: -use_mock_srv option is not used if enough filenames given for -rspin%s%s%s %s:%s:%d:CMP %s: cannot set up CMP context%s%s%s %s:%s:%d:CMP %s: Missing -cacertsout option for -infotype caCerts%s%s%s %s:%s:%d:CMP %s: no CA certificates provided by server%s%s%s %s:%s:%d:CMP %s: Failed to store CA certificates from genp in %s%s%s %s:%s:%d:CMP %s: Missing -newwithnew option for -infotype rootCaCert%s%s%s %s:%s:%d:CMP %s: No -oldwithold given, will use all certs given with -trusted as trust anchors for verifying the newWithNew cert%s%s%s OldWithOld cert for genm with -infotype rootCaCert%s:%s:%d:CMP %s: no root CA certificate update available%s%s%s %s:%s:%d:CMP %s: oldWithNew certificate received in genp for verifying oldWithOld, but oldWithOld was not provided%s%s%s %s:%s:%d:CMP %s: Missing -oldcrl and no -crlcert given for -infotype crlStatusList%s%s%s %s:%s:%d:CMP %s: Missing -crlout for -infotype crlStatusList%s%s%s Cert for genm with -infotype crlStatusListCRL for genm with -infotype crlStatusList%s:%s:%d:CMP %s: -oldcrl and -crlcert have different issuer%s%s%s %s:%s:%d:CMP %s: no CRL update available%s%s%s %s:%s:%d:CMP %s: received %s, saving to file '%s'%s %s:%s:%d:CMP %s: could not open file '%s' for writing %s%s error: unsupported type '%s' for writing CRLs %s:%s:%d:CMP %s: cannot write %s to file '%s'%s %s:%s:%d:CMP %s: no certificate request template available%s%s%s %s:%s:%d:CMP %s: error saving certTemplate from genp: cannot open file %s%s%s %s:%s:%d:CMP %s: error saving certTemplate from genp: cannot write file %s%s%s %s:%s:%d:CMP %s: stored certTemplate from genp to file '%s'%s%s specifications contained in keySpec from genp%s:%s:%d:CMP %s: Out of memory - cannot dump key %s%s%s %s:%s:%d:CMP %s: Info too large - cannot dump key %s%s%s %s:%s:%d:CMP %s: no key specifications available%s%s%s %s:%s:%d:CMP %s: error saving keySpec from genp: cannot open file %s%s%s %s:%s:%d:CMP %s: error saving keySpec from genp: cannot write file %s%s%s %s:%s:%d:CMP %s: stored keySpec from genp to file '%s'%s%s %s:%s:%d:CMP %s: No specific support for -infotype %s available%s%s %s:%s:%d:CMP %s: Failed to create genm for -infotype %s%s%s %s:%s:%d:CMP %s: genp does not contain any ITAV%s%s%s %s:%s:%d:CMP %s: could not get ITAV #%d from genp%s%s %s:%s:%d:CMP %s: error parsing type of ITAV #%d from genp%s%s %s:%s:%d:CMP %s: ITAV #%d from genp infoType=%s%s %s:%s:%d:CMP %s: Did not receive response on genm or genp is not valid%s%s%s %s:%s:%d:CMP %s: received%s%s %s Centrally generated private key password%s:%s:%d:CMP %s: saving centrally generated key to file '%s'%s%s Configuration file to use. "" = none. Default from env variable OPENSSL_CONFSection(s) in config file to get options from. "" = 'default'. Default 'cmp'Log level; 3=ERR, 4=WARN, 6=INFO, 7=DEBUG, 8=TRACE. Default 6 = INFOCMP request to send: ir/cr/kur/p10cr/rr/genmInfoType name for requesting specific info in genm, with specific supportfor 'caCerts' and 'rootCaCert'Certificate profile name to place in generalInfo field of request PKIHeaderComma-separated list of OID and value to place in generalInfo PKIHeaderof form :int: or :str:, e.g. '1.2.3.4:int:56789, id-kp:str:name'File to save certTemplate received in genp of type certReqTemplateOptional file to save Key specification received in genp of type certReqTemplateCertificate enrollment options: Private or public key for the requested cert. Default: CSR key or client keyNew private key pass phrase sourceRequest central (server-side) key generation. Default is local generationFile to save centrally generated key, in PEM formatDistinguished Name (DN) of subject to use in the requested cert templateFor kur, default is subject of -csr arg or reference cert (see -oldcert)this default is used for ir and cr only if no Subject Alt Names are setRequested validity time of the new certificate in number of daysName of config file section defining certificate request extensions.Augments or replaces any extensions contained CSR given with -csrSubject Alt Names (IPADDR/DNS/URI) to add as (critical) cert req extensionDo not take default SANs from reference certificate (see -oldcert)Name of config file section defining policies certificate request extensionPolicy OID(s) to add as policies certificate request extensionFlag the policy OID(s) given with -policy_oids as criticalProof-of-Possession (POPO) method to use for ir/cr/kur where-1 = NONE, 0 = RAVERIFIED, 1 = SIGNATURE (default), 2 = KEYENCPKCS#10 CSR file in PEM or DER format to convert or to use in p10crCertificates to trust when verifying newly enrolled certificatesRequest implicit confirmation of newly enrolled certificatesDo not confirm newly enrolled certificate w/o requesting implicitconfirmation. WARNING: This leads to behavior violating RFC 9810File to save newly enrolled certificateFile to save the chain of newly enrolled certificateCertificate enrollment and revocation options: Certificate to be updated (defaulting to -cert) or to be revoked in rr;also used as reference (defaulting to -cert) for subject DN and SANs.Issuer is used as recipient unless -recipient, -srvcert, or -issuer givenDN of the issuer to place in the certificate template of ir/cr/kur/rr;also used as recipient if neither -recipient nor -srvcert are givenSerial number of certificate to be revoked in revocation request (rr)Reason code to include in revocation request (rr); possible values:0..6, 8..10 (see RFC5280, 5.3.1) or -1. Default -1 = none included[http[s]://]address[:port][/path] of CMP server. Default port 80 or 443.address may be a DNS name or an IP address; path can be overridden by -path[http[s]://]address[:port][/path] of HTTP(S) proxy to use; path is ignoredList of addresses of servers not to use HTTP(S) proxy forDefault from environment variable 'no_proxy', else 'NO_PROXY', else noneDN of CA. Default: subject of -srvcert, -issuer, issuer of -oldcert or -certHTTP path (aka CMP alias) at the CMP server. Default from -server, else "/"Persistent HTTP connections. 0: no, 1 (the default): request, 2: requireNumber of seconds allowed per CMP message round trip, or 0 for infiniteOverall time an enrollment incl. polling may take. Default 0 = infiniteServer authentication options: Certificates to use as trust anchors when verifying signed CMP responsesIntermediate CA certs for chain construction for CMP/TLS/enrolled certsServer cert to pin and trust directly when verifying signed CMP responsesDN of expected sender of responses. Defaults to subject of -srvcert, if anyIgnore CMP signer cert key usage, else 'digitalSignature' must be allowedAccept missing or invalid protection of regular error messages and negativecertificate responses (ip/cp/kup), revocation responses (rp), and PKIConfWARNING: This setting leads to behavior allowing violation of RFC 9810Do not keep certificates received in the extraCerts CMP message fieldFile to save the server cert used and validated for CMP response protectionFile to save extra certificates received in the extraCerts fieldFile to save CA certs received in caPubs field or genp with id-it-caCertsRoot CA certificate to request update for in genm of type rootCaCertFile to save NewWithNew cert received in genp of type rootCaKeyUpdateFile to save NewWithOld cert received in genp of type rootCaKeyUpdateFile to save OldWithNew cert received in genp of type rootCaKeyUpdatecertificate to request a CRL for in genm of type crlStatusListCRL to request update for in genm of type crlStatusListFile to save new CRL received in genp of type 'crls'Client authentication options: Reference value to use as senderKID in case no -cert is givenPrefer PBM (over signatures) for protecting msgs with given password sourceClient's CMP signer certificate; its public key must match the -key argumentThis also used as default reference for subject DN and SANs.Any further certs included are appended to the untrusted certsOptional certs to verify chain building for own CMP signer certCMP signer private key, not used when -secret givenClient private key (and cert and old cert) pass phrase sourceDigest to use in message protection and POPO signatures. Default "sha256"MAC algorithm to use in PBM-based message protection. Default "hmac-sha1"Certificates to append in extraCerts field of outgoing messages.This can be used as the default CMP signer cert chain to includeSend request messages without CMP-level protectionFormat (PEM or DER) to use when saving a certificate to a file. Default PEMFormat (PEM or DER) to use when saving a CRL to a file. Default DERFormat of the key input (ENGINE, other values ignored)Pass phrase source potentially needed for loading certificates of othersUse crypto engine with given identifier, possibly a hardware device.Engines may also be defined in OpenSSL config file engine section.Enable using TLS (also when other TLS options are not set)Client's TLS certificate. May include chain to be provided to TLS serverPrivate key for the client's TLS certificatePass phrase source for the client's private TLS key (and TLS cert)Extra certificates to provide to TLS server during TLS handshakeTrusted certificates to use for verifying the TLS server certificate;this implies hostname validationAddress to be checked (rather than -server) during TLS hostname validationClient-side debugging options: Do not interactively prompt for input when a password is required etc.Invoke the transaction the given positive number of times. Default 1Take sequence of CMP requests to send to server from file(s)Use fresh transactionID for CMP requests read from -reqinSave sequence of CMP requests created by the client to file(s)Save first CMP request created by the client to file and exitProcess sequence of CMP responses provided in file(s), skipping serverSave sequence of actually used CMP responses to file(s)Use internal mock server at API level, bypassing socket-based HTTPAct as HTTP-based mock server listening on given portmax number of messages handled by HTTP mock server. Default: 0 = unlimitedReference value to use as senderKID of server in case no -srv_cert is givenPassword source for server authentication with a pre-shared key (secret)Private key used by the server for signing messagesServer private key (and cert) pass phrase sourceTrusted certificates for client authenticationIntermediate certs that may be useful for verifying CMP protectionCertificate to be expected for rr and any oldCertID in kur messagesCertificate to be returned as mock enrollment resultPrivate key for the certificate to be returned as mock enrollment resultKey to be returned for central key pair generationResponse private key (and cert) pass phrase sourceCRL to be returned in genp of type crlsExtra certificates to be included in mock certification responsesCA certificates to be included in mock ip responseNew root CA certificate to include in genp of type rootCaKeyUpdateNewWithOld transition cert to include in genp of type rootCaKeyUpdateOldWithNew transition cert to include in genp of type rootCaKeyUpdateNumber of times the client must poll before receiving a certificateThe check_after value (time to wait) to include in poll responseGrant implicit confirmation of newly enrolled certificatePKIStatus to be included in server response. Possible values: 0..6A single failure info bit number to include in server response, 0..26Number representing failure bits to include in server response, 0..2^27 - 1Status string to be included in server responseForce server to reply with error messageSend response messages without CMP-level protectionIn case of negative responses, server shall send unprotected error messages,certificate responses (ip/cp/kup), and revocation responses (rp).WARNING: This setting leads to behavior violating RFC 9810Accept missing or invalid protection of requestsAccept unprotected error messages from clientAccept RAVERIFIED as proof-of-possession (POPO)adds policy to the acceptable policy setchain authentication security levelpermit unhandled critical extensionscheck leaf certificate revocationset policy variable require-explicit-policyset policy variable inhibit-any-policyset policy variable inhibit-policy-mappingdisable certificate compatibility work-aroundsprint policy processing diagnosticssearch trust store first (default)Suite B 128-bit mode allowing 192-bit algorithmsaccept chains anchored by intermediate trust-store CAsignore certificate validity timeallow the use of proxy certificatesError allocating CMS_contentinfo Error reading %s Content Info Invalid key (supplied twice) %s Invalid id (supplied twice) %s Invalid OID (supplied twice) %s Illegal -inkey without -signer No Signed Receipts Recipients Signed receipts only allowed with -sign Multiple signers or keys not allowed Incompatible options: CAdES requires signed attributes Incompatible options: CAdES validation requires certs and signed attributes validations No signer certificate specified No recipient certificate or key specified No recipient(s) certificate(s) specified No operation option (-encrypt|-decrypt|-sign|-verify|...) specified. Warning: -nodetach option is ignored for non-signing operation Warning: -contfile option is ignored for the given operation Warning: recipient certificate file parameters ignored for operation other than -encrypt receipt signer certificate fileCannot use -digest for non-signing operation Cannot use -digest when -in, -nodetach or streaming is used Invalid hex value after -digest Cannot use originator for encryption Signed Receipt Request Creation Error Error decrypting CMS using secret key Error decrypting CMS using private key Error decrypting CMS using password Error decrypting CMS structure Receipt Request Parse Error Bad output format for CMS file Usage: %s [options] [cert...] Load a configuration file (this may load modules)Generate a signed receipt for a messageVerify receipts; exit if receipt signatures do not verifySign a pre-computed digest in hex notationCreate a CMS "DigestedData" objectVerify a CMS "DigestedData" object and output itCreate a CMS "CompressedData" objectUncompress a CMS "CompressedData" objectCreate CMS "EncryptedData" object using symmetric keyDecrypt CMS "EncryptedData" object using symmetric keyCopy CMS "Data" object to outputInput format SMIME (default), PEM or DEROutput format SMIME (default), PEM or DERTreat input as binary: do not translate to canonical formUse CRLF as EOL termination instead of LF onlyPerform CRLF canonicalisation when signingSpecific password for recipientUse specified hex-encoded key to decrypt/encrypt recipients or contentIdentity of the -secretkey for CMS "KEKRecipientInfo" objectInput private key (if not signer or recipient)Set public key parameters as n:v pairsInput private key format (ENGINE, other values ignored)Use engine e, possibly a hardware deviceEncryption and decryption options: Recipient certs (optional; used only when encrypting)The encryption algorithm to use (any supported cipher)Key wrap algorithm to use when encrypting with key agreementDisable MMA protection, return error if no recipient found (see doc)Extra signer and intermediate CA certificates to include when signingor to use as preferred signer certs and for chain building when verifyingInclude signingCertificate attribute (CAdES-BES)Don't include signer's certificate when signingDon't include any signed attributesOmit the SMIMECapabilities attributeOmit the signing time attributeWhen signing, create a receipt request for all recipientsWhen signing, create a receipt request for first recipientCreate signed receipt request with specified email addressCreate signed receipt targeted to specified addressSigner certificate(s) output fileSupply or override content for detached signatureDo not verify signed content signaturesDo not verify signed attribute signaturesDon't verify message signatureDon't verify signers certificateDon't search certificates in message for signerCheck signingCertificate (CAdES-BES)Exit non-zero on verification failureTrusted certificates directoryTrusted certificates store URIDo not load the default certificates fileDo not load certificates from the default certificates directoryDo not load certificates from the default certificates storeInclude or delete text MIME headersFor the -cmsout operation do not output the parsed CMS structureFor the -cmsout operation print out all fields of the CMS structureFor the -print option specifies various strings printing optionsError initialising X509 store Error getting CRL issuer certificate Error getting CRL issuer public key CRL input format (DER or PEM); has no effectCRL signing Private key to usePrivate key file format (DER/PEM/P12); has no effectPrint out a text format versionPrint old-style (MD5) hash valueCertificate subject/issuer name printing optionsCorrupt last byte of loaded CRL signature (for test)Other CRL to compare/diff to the Input oneVerify CRL using certificates in dirVerify CRL using certificates in file nameVerify CRL using certificates in store URINo crl to load, just certs from '-certfile'File of chain of certs to a trusted CA; can be repeatedError getting maximum length of signed data key must be set for one-shot algorithms %s: Can only sign or verify one file. No signature to verify: use the -signature option MAC and signing key cannot both be specified Signature parameter error "%s" Error opening signature file %s Error reading signature file %s Length can only be specified for XOF Signing key cannot be specified for XOF Usage: %s [options] [file...] Also use engine given by -engine for digest operationsPrint the digest with separating colonsPrint the digest in coreutils formatOutput to filename rather than stdoutKey file format (ENGINE, other values ignored)Output length for XOF algorithms. To obtain the maximum security strength set this to 32 (or greater) for SHAKE128, and 64 (or greater) for SHAKE256Verify a signature using public keyVerify a signature using private keyCreate MAC (not necessarily HMAC)MAC algorithm parameters in n:v form or keyCompute HMAC with the key used in OpenSSL-FIPS fingerprintFiles to digest (optional; default is stdin)Error, failed to set DH parameters Error, generator may not be chosen for DSA parameters Warning, input file %s ignored Error, %s param generation context allocation failed Generating %s parameters, %d bit long %sprime Error, unable to initialise %s parameters Error, unable to set DSA prime length Error, unable to set DH prime length Error, unable to set generator Error, unable to load parameters Error, unable to load DSA parameters Error, unable to load DH parameters Error, failed to check DH parameters Error, invalid parameters generated DH parameters appear to be ok. Error, unable to write DH parameters Usage: %s [options] [numbits] Read or generate DSA parameters, convert to DHPrint a text form of the DH parametersDon't output any DH parametersGenerate parameters using 2 as the generator valueGenerate parameters using 3 as the generator valueGenerate parameters using 5 as the generator valueNumber of bits if generating parameters (optional)PVK form impossible with public key input bad output format specified for outfile Enable 'Strong' PVK encoding level (default)Enable 'Weak' PVK encoding levelInput format (DER/PEM/PVK); has no effectExpect a public key in input fileOutput public key, not privateOutput file pass phrase sourceError, DSA parameter generation context allocation failed Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %d! Larger key size may behave not as expected. Generating DSA parameters, %d bit long prime Error, DSA key generation paramgen init failed Error, DSA key generation setting bit length failed Error, DSA key generation setting subprime bit length failed Error, unable to write DSA parameters Error, DSA key generation context allocation failed Error, unable to initialise for key generation Usage: %s [options] [numbits] [numqbits] Number of bits if generating parameters or key (optional)Number of bits in the subprime parameter q if generating parameters or key (optional)unable to set point conversion format unable to set asn1 encoding format unable to disable public key encoding unable to enable public key encoding Input format (DER/PEM/P12/ENGINE)Specifies the way the ec parameters are encodedSpecifies the point conversion form Print the elliptic curve parametersexclude public key from private keyCURVE DESCRIPTION NOT AVAILABLEusing curve name prime192v1 instead of secp192r1 using curve name prime256v1 instead of secp256r1 Unable to load parameters from %s checking elliptic curve parameters: unable to write elliptic curve parameters Prints a list of all curve 'short names'Input format - default PEM (DER or PEM)Print the ec parameters in text formCheck that named EC curve parameters have not been modifiedIf 'explicit' parameters are chosen do not use the seedUse the ec parameters with specified 'short name'hex string is too long, ignoring excess hex string is too short, padding with zero bytes to length *** WARNING : deprecated key derivation used. Using -iter or -pbkdf2 would be better. warning: iv not used by this cipher Either a raw key or the 'skeyopt' args must be used. Error creating opaque key object for skeymgmt %s Error setting an opaque key for cipher %s Base64 encode/decode, depending on encryption flagUsed with -[base64|a] to specify base64 buffer as a single lineDisable standard block paddingUse specified digest to create a key from the passphraseSpecify the iteration count and force the use of PBKDF2Use password-based key derivation function 2 (PBKDF2)Use -iter to change the iteration count from 10000Specify the PBKDF2 salt length (in bytes)Key options as opt:value for opaque symmetric key handlingSymmetric key management name for opaque symmetric key handling[Error]: internal stack error [Error]: command name too long %s: Cannot mix flags and engine names. Usage: %s [options] engine... Check that specified engine is availableRun command against the ENGINE before loading itRun command against the ENGINE after loading itList 'control commands' For each specified engineAlso display each command's descriptionAlso add the input flags for each commandAlso show internal input flagsList the capabilities of specified engineDisplay error trace for unavailable enginesCommands are like "SO_PATH:/lib/libdriver.so"Usage: %s [options] errnum... Cannot specify -%s after -pedantic Missing -in option for -verify hexkey:f4556650ac31d35461610bac4ed81b1a181b2d8a43ea2854cbae22ca74560813Unable to create MAC CTX for module check Unable to create MAC CTX for install indicator Module integrity MAC not found Install indicator MAC not found Install indicator status mismatch providers = provider_section Failed to query FIPS module parameters Set options for strict FIPS complianceVerify a config file instead of generating oneFile name of the provider moduleFIPS Provider config section name (optional)Disable the ability of the fips module to enter an error state if any conditional self tests failDisable the run-time FIPS security checks in the moduleForces self tests to always run on module loadForces self tests to run once on module installationEnable the run-time FIPS check for EMS during TLS1_PRFDisallow truncated digests with Hash and HMAC DRBGsEnable checking for approved digests for signaturesEnable digest check for TLS13-KDFEnable digest check for TLS1-PRFEnable digest check for SSHKDFEnable digest check for X963KDFDisallow Triple-DES encryptionDisallow PKCS#1 version 1.5 padding for RSA encryptionEnable salt length check for RSA-PSS signature operationsDisallow X931 Padding for RSA signingEnable key check for TLS13-KDFDisable lower bound check for PBKDF2Enable Cofactor check for ECDHInput config file, used when verifyingOutput config file, used when generatingMAC algorithm parameters in n:v form.See 'PARAMETER NAMES' in the EVP_MAC_ docsDisable logging of self test eventsCorrupt a self test by descriptionunable to create PKEY context unable to set up for key generation unable to output generated key Usage: %s [options] dsaparam-file Output the key to the specified fileEncrypt the output with any supported cipherFile containing DSA parametersError initializing %s context The possible -pkeyopt arguments are: Error reading parameter file %s %s: Error setting %s parameter: Cannot use cipher with -genparam option Error writing to outpubkey: '%s'. Error: %s Error writing to outfile: '%s'. Error: %s Output status while generating keysDo not output status while generating keysSet the public key algorithm option as opt:valueCipher to use to encrypt the keyOrder of options may be important! See the documentation. Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %d! Larger key size may behave not as expected. Error allocating RSA public exponent Error setting RSA public exponent Error setting number of primes (deprecated) Use 3 for the E valueUse the Fermat number F4 (0x10001) for the E valueOutput the key to specified fileUse traditional format for private keysDefault configuration file directoryDefault engine module directoryDefault module directory (other than engine modules)Configured extension for modulesKDF algorithm control parameters in n:v formSee 'Supported Controls' in the EVP_KDF_ docs The size of the output derived keyOutput in binary format (default is hexadecimal)retrievable algorithm parametersretrievable operation parameterssettable key generation parameters Provided Asymmetric Encryption: Provided RNGs and seed sources: ERROR: could not list all provider signature algorithms No TLS sig algs registered by currently active providersERROR: setting TLS protocol version ERROR: getting implemented TLS group list WARNING: Unable to query provider parameters for %s Invalid command '%s'; type "help" for a list. List of message digest commands (deprecated)List of message digest algorithmsList of key derivation and pseudo random function algorithmsList the primary, public and private random number generator detailsList of random number generatorsList of message authentication code algorithmsList of cipher commands (deprecated)List of symmetric cipher algorithmsList of symmetric key managersList of key exchange algorithmsList of key encapsulation mechanism algorithmsList of TLS signature algorithmsList of asymmetric cipher algorithmsList implemented TLS key exchange 'groups'List implemented TLS key exchange 'groups' and all aliasesWhen listing 'groups', list those compatible with TLS1.2When listing 'groups', list those compatible with TLS1.3List options for specified commandList built in objects (OID<->name mappings)MAC algorithm parameters in n:v formInput file to MAC (default is stdin)%s: Error reading certs file %s %s: Error reading sequence file %s %s Error parsing -url argument No issuer certificate specified Error converting serial number %s Missing = in header key=value %s: Digest must be before -cert or -serial Error loading responder certificate Responder mode requires certificate, key, and CA. waiting for OCSP client connections...error reloading updated index: %sNeed an OCSP request for this operation! Error loading signer certificate Error querying OCSP responder WARNING: no nonce in response WARNING: Status times invalid. Ignore error on OCSP request or response and continue runningConnection timeout (in seconds) to the OCSP responderDon't include any certificates in responserun multiple responder processesDon't include any certificates in signed requestCorrupt last byte of loaded OCSP response signature (for test)Number of minutes before next updateNumber of requests to accept (default unlimited)File with the DER-encoded requestCertificate to sign OCSP request withAdditional certificates to include in signed requestNumber of days before next updateResponder certificate to sign responses withResponder key to sign responses withResponder key pass phrase sourceOther certificates to include in responseDigest Algorithm to use in signature of OCSP responseOCSP response signature parameter in n:v formUse specified algorithm for cert id in responseAny supported digest algorithm (sha1,sha256, ... )TCP/IP hostname:port to connect to[http[s]://]host[:port][/path] of HTTP(S) proxy to use; path is ignoredDon't add OCSP nonce to requestDon't check signature on responseIdentify response by signing certificate key IDDon't check signing certificatePrint text form of request and responseDon't do additional checks on signing certificateDo not explicitly check the chain, just verify the rootDon't verify additional certificatesDon't search certificates contained in response for signerFile with the DER-encoded responseAdditional certificates to search for signerCertificate to check; may be given multiple timesSerial number to check; may be given multiple timesMaximum validity discrepancy in secondsPrivate key to sign OCSP request withOutput file for the DER-encoded requestOutput file for the DER-encoded responseThe command %s was deprecated in version %s.FATAL: Startup failure (dev note: %s()) for %s %s: could not get default config file Message Digest commands (see the `dgst' command for more details) Cipher commands (see the `enc' command for more details) Usage: help [options] [command] Name of command to display help (optional)Warning: truncating password to %u characters %s: Can't combine -in and -stdin Usage: %s [options] [password] Never verify when reading password from terminalSHA512-based password algorithmSHA256-based password algorithmMD5-based password algorithm, Apache variantAIX MD5-based password algorithmPassword text to digest (optional), Salt length: %d, Cost(N): %ld, Block size(r): %ld, Parallelism(p): %ldWarning unsupported bag type: Warning: -%s option ignored with -export Warning: output encryption option -%s ignored with -export Warning: -%s option ignored without -export Error getting certificate file password Option -twopass cannot be used with -passout or -password Option -twopass cannot be used with -passin or -password Nothing to export due to -noout or -nocerts and -nokeys Warning: -chain option ignored with -nocerts No certificate in -in file %s No cert in -in file '%s' matches private key No end entity certificate to check with -chain extra certificates from -certfileError creating PKCS12 structure for %s Error creating PKCS12 MAC; no PKCS12KDF support? Use -nomac or -pbmac1_pbkdf2 if PKCS12KDF support not available , Unsupported KDF or params for PBMAC1 Key length: %ld, Salt length: %d MAC length: %ld, salt length: %ld Error verifying PKCS12 MAC; no PKCS12KDF support. Use -nomacver if MAC verification is not required. Verbatim password did not match, and fallback conversion to UTF-8 failed The password entered or the input encoding may be wrong Mac verify error: invalid password? Warning: using broken algorithm Error outputting keys and certificates Set PKCS#12 import/export password sourceSeparate MAC, encryption passwordsDon't output anything, just verify PKCS#12 inputUse legacy encryption: 3DES_CBC for keys, RC2_CBC for certsPKCS#12 import (parsing PKCS#12) options: Print info about PKCS#12 structureOnly output client certificatesAny supported cipher for output encryptionDon't encrypt private keys; deprecatedPKCS#12 output (export) options: Private key, else read from -in input fileExtra certificates for PKCS12 outputCertificate file pass phrase sourceBuild and add certificate chain for EE cert,which is the 1st cert from -in matching the private key (if given)Untrusted certificates for chain buildingUse name as CA friendly name (can be repeated)Add local machine keyset attribute to private keySet key type to MS key exchangeSet key type to MS key signaturePrivate key PBE algorithm (default AES-256 CBC)Certificate PBE algorithm (default PBES2 with PBKDF2 and AES-256 CBC)Encrypt output with 3DES (default PBES2 with PBKDF2 and AES-256 CBC)Digest algorithm to use in MAC (default SHA256)Use PBMAC1 with PBKDF2 instead of MACDigest to use for PBMAC1 KDF (default SHA256)Specify the iteration count for encryption and MACDon't use encryption iterationUnused, kept for backwards compatibilityMark certificate in PKCS#12 store as trusted for JDK compatibilityunable to allocate PKCS7 object Print full details of certificatesPrint out all fields of the PKCS7 structurePrint_certs print any certs or crl in the inputWhen used with -print_certs, it produces a cleaner outputSet the PRF algorithm to use with PKCS#5 v2.0Use or expect unencrypted private keyuse traditional format private keySpecify the salt length (in bytes)Default: 8 (For PBE1) or 16 (for PBE2)Warning: The -text option is ignored with -text_pub Warning: The -traditional is ignored since there is no PEM output Warning: The -passout option is ignored without a cipher option Error: Cipher options are supported only for PEM output Error: Text output cannot be combined with DER output Key input format (ENGINE, other values ignored)Read only public components from key inputOutput file for encoded and/or text outputOutput encoding format (DER or PEM)Any supported cipher to be used for encryptionOutput PEM file pass phrase sourceUse traditional format for private key PEM outputRestrict encoded output to public componentsDo not output the key in encoded formOutput key components in plaintextOutput only public key components in text formSpecifies the EC point conversion form in the encodingSpecifies the way the EC parameters are encodedDon't output encoded parametersError: unable to determine file size for oneshot operation Error verifying raw input data %s: no KDF length given (-kdflen parameter). %s: no private key given (-inkey parameter). %s: -peerkey option not allowed without -derive. %s: missing -peerkey option for -derive operation. A private key is needed for this operation %s: -verifyrecover can be used only with RSA %s: -rev cannot be used with raw input %s: -digest (prehash) is not supported with %s %s: -digest and -rawin can only be used with -sign or -verify The given KDF "%s" is unknown. %s: Error initializing context Type of peer public key: %s does not match type of private key: %s %s: Error setting up peer key %s: Can't set parameter "%s": %s: Signature file specified for non verify %s: No signature file specified for verify %s: Decapsulation produces only a shared secret and no output. The '-out' option is not applicable. KEM-based shared-secret derivation requires the '-secret ' option Error: The non-raw input data length %zd is too long - max supported hashed size is %d Signature Verified Successfully Signature Verification Failure Also use engine given by -engine for crypto operationsSign input data with private keyEncrypt input data with public keyDecrypt input data with private keyDerive shared secret from own and peer (EC)DH keysInput key, by default private keyPeer key file used in key derivationPeer key format (DER/PEM/P12/ENGINE)Input is a cert with a public keyReverse the order of the input bufferSignature file (verify operation only)Private key format (ENGINE, other values ignored)File to store secret on encapsulationparse the output as ASN.1 data to check its DER encoding and print errorsVerify RSA signature, recovering original signature input dataSigning/Derivation/Encapsulation options: Indicate that the signature/verification input data is not yet hashedThe digest algorithm to use for signing/verifying raw input data. Implies -rawinPublic key options as opt:valuePublic key option that is read as a passphrase argument opt:passphraseKEM operation specific to the key algorithmUsage: %s [options] [number...] When used with -generate, generate a safe primeNumber(s) to check for primality if not generating%lu bytes with suffix overflows Request exceeds max allowed output Usage: %s [options] num[K|M|G|T] %s: warning: skipping duplicate %s in %s %s: error: hash table overflow for %s %s: error: skipping %s, cannot open file %s: warning: skipping %s, it does not contain exactly one certificate or CRL %s: error calculating SHA1 hash value Usage: %s [options] [directory...] Create both new- and old-style hash linksUse old-style hash to generate linksOne or more directories to process (optional)Missing newline at end of input String too short, must be at least %d bytes long String too long, must be at most %d bytes long issuer private key from -CA argissuer private key from -CAkey arg%s: -days parameter arg must be >= -1 Parse error on -addext: missing '=' Parse error on -addext: missing key Internal error handling -addext %s Warning: Ignoring -days without -x509; not generating a certificate Warning: Ignoring -not_before without -x509; not generating a certificate Warning: Ignoring -not_after without -x509; not generating a certificate Warning: Ignoring -copy_extensions 'none' when -x509 is not given Warning: Will read cert request from stdin since no -in option is given Using additional configuration from -addext options Problems opening '%s' for extra OIDs Error checking %s extension section %s Error checking extensions defined using -addext Warning: Not generating key via given -newkey option since -key is given Parameter file requested but no path given: %s Cannot open parameter file %s Key type does not match parameters Error allocating keygen context Error initializing keygen context Private key length too short, needs to be at least %d bits, not %ld. Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: Not placing -key in cert or request since request is used Warning: Ignoring -in option since -new or -newkey or -precert is given Warning: Ignoring -CAkey option since no -CA option is given Issuer CA certificate and key do not match Must provide a signature key using -key or provide -CA / -CAkey Error: No objects specified in config file You are about to be asked to enter information that will be incorporated into your certificate request. What you are about to enter is what is called a Distinguished Name or a DN. There are quite a few fields but you can leave some blank For some fields there will be a default value, If you enter '.', the field will be left blank. Please enter the following 'extra' attributes to be sent with your certificate request No template, please set one up. Error making certificate request Warning: Not using -key or -newkey for signing since -CA option is given Warning: -not_after option overriding -days option Warning: No -copy_extensions given; ignoring any extensions in the request Error copying extensions from request Error adding x509 extensions from section %s Error adding x509 extensions defined via -addext Error adding poison extension Warning: Ignoring -precert flag since no cert is produced Error adding request extensions from section %s Error adding request extensions defined via -addext Modifying subject of certificate request Error modifying subject of certificate request Certificate request self-signature verify failure Certificate request self-signature verify OK Error printing certificate request Unable to write certificate request Unable to write X509 certificate Specify the cipher for private key encryptionSpecify engine to be used for key generation operationsX.509 request input file (default stdin)Verify self-signature on the requestConfig section to use (default "req")Input characters are UTF8 (default ASCII)Output an X.509 certificate structure instead of a cert requestRequest cert generation with X.509 version 1Issuer cert to use for signing a cert, implies -x509Issuer private key to use with -CA; default is -CA argSet or modify subject of request or certPrint the subject of the output request or certNumber of days certificate is valid forcopy extensions from request when using -x509Cert or request extension section (override value in config file)Additional cert extension key=value pair (may be given more than once)Add a poison extension to generated cert (implies -new)Key for signing, and to include unless -in givenPrivate key and certificate password sourceGenerate new key with [:] or [:] or param:Do not ask anything during request generationOutput "NEW" in the header linesOnly private keys can be checked RSA unable to create PKEY context Output format, one of DER PEM PVKInput key, by default an RSA private keyInput key is an RSA public pkeyInput is a cert carrying an RSA public keyUse PKCS#1 v1.5 padding (default)Run output through asn1parse; useful with -verify ====================================== ====================================== Protocols advertised by server: NULL received PSK identity hint, continuing anyway Received PSK identity hint '%s' Could not convert PSK key '%s' to buffer psk buffer of callback is too small (%d) for key (%ld) Error finding suitable ciphersuite a:PKEY: %s, (%s); sigalg: %s a:PKEY: %s, %d (bit); sigalg: %s no peer certificate available Client-to-server raw public key negotiated Server-to-client raw public key negotiated --- SSL handshake has read %ju bytes and written %ju bytes SRTP Extension negotiated, profile=%s Error writing session file %s --- Post-Handshake New Session Ticket arrived: %s: Intermixed protocol flags (unix and internet domains) %s: Intermixed protocol flags (internet and unix domains) Cannot supply multiple protocol flags Cannot supply both a protocol flag and '-no_' Error getting client auth engine SRP minimal length for N is %d %s: Max Fragment Len %u is out of permitted values%s: cannot provide both -connect option and target parameter %s: Can't use -servername and -noservername together %s: Can't use -dane_tlsa_domain and -noservername together Cannot supply -nextprotoneg with TLSv1.3 %s: -connect argument or target parameter malformed or ambiguous %s: -proxy requires use of -connect or target parameter %s: -proxy argument malformed or ambiguous %s: -bind argument parameter malformed or ambiguous Can't use unix sockets and datagrams together Error parsing -nextprotoneg argument Error getting private key password Error: Must specify proxy_user with proxy_pass client certificate private keyError using configuration "%s" %s: Max send fragment size %u is out of permitted range %s: Split send fragment size %u is out of permitted range %s: Max pipelines %u is out of permitted range %s: Max Fragment Length code %u is out of permitted values Error loading store locations Error setting client auth engine PSK key given, setting client callback Can't open PSK session file %s Can't read PSK session file %s Warning: Unable to add custom extension %u, skipping %s: Error enabling DANE TLSA authentication. Error setting client certificate types Error setting server certificate types Unable to set TLS servername extension. %s: DANE TLSA authentication requires at least one -dane_tlsa_rrdata option. %s: warning: bad TLSA %s field in: %s %s: warning: unusable TLSA rrdata: %s %s: warning: error loading TLSA rrdata: %s %s: Failed to import any TLSA records. %s: DANE TLSA authentication requires the -dane_tlsa_domain option. %s: DTLS does not support the -tfo option %s: QUIC does not support the -tfo option %s: QUIC requires ALPN to be specified (e.g. "h3" for HTTP/3) via the -alpn option MTU too small. Must be at least %ld Failed to set the initial peer address Didn't find STARTTLS in server response, trying anyway... Timeout waiting for response (%d seconds). Server does not support STARTTLS. MySQL packet length does not match. Only MySQL protocol version 10 is supported. Cannot confirm server version. MySQL server handshake packet is broken. MySQL server does not support SSL. ldap_ExtendedResponse_parse failed STARTTLS failed, LDAP Result Code: %i drop connection and then reconnect ERROR PROCESSING COMMAND. REST OF LINE IGNORED: %s UNRECOGNISED COMMAND (IGNORED): %s Enter text to send to the peer followed by To issue a command insert {cmd} or {cmd:arg} anywhere in the text Entering {{ will send { to the peer The following commands are available {quit}: Close the connection to the peer {reconnect}: Reconnect to the peer {fin}: Send FIN on the stream. No further writing is possible {keyup:req|noreq}: Send a Key Update message Arguments: req = peer update requested (default) noreq = peer update not requested {reneg}: Attempt to renegotiate BAD ARGUMENT (COMMAND IGNORED): %s Usage: %s [options] [host:port] Specify engine to be used for client certificate operationsUse specified section for SSL_CTX configurationRequest and parse SCTs (also enables OCSP stapling)Do not request or parse SCTs (default)TCP/IP where to connect; default: 4433)bind local address for connectionConnect to via specified proxy to the real serverUserID for proxy authenticationProxy authentication password sourceConnect over the specified Unix-domain socketEnable Maximum Fragment Length Negotiation (len values: 512, 1024, 2048 and 4096)Size used to split data for encrypt pipelinesMaximum number of encrypt/decrypt pipelines to be usedDefault read buffer size to be used for connectionsClient certificate file to useClient certificate file format (PEM/DER/P12); has no effectClient certificate chain file (in PEM format)Build client certificate chainPrivate key file to use; default: -cert fileKey format (ENGINE, other values ignored)Private key and cert file pass phrase sourceTurn on peer certificate verificationPEM format file of CA names to send to the serverDANE TLSA rrdata presentation formDisable name checks when matching DANE-EE(3) TLSA recordsFile to read PSK SSL session fromHostname to use for "-starttls lmtp", "-starttls smtp" or "-starttls xmpp[-server]"Drop and re-make the connection with the same Session-IDConvert LF from terminal into CRLFIgnore input eof (default when -quiet)Use the appropriate STARTTLS command before starting TLSAlias of -name option for "-starttls xmpp[-server]"Restrict output to brief summary of connection parametersPrint session information when the program exitsDon't run the client in the interactive modeShow all certificates sent by the serverFile to send output of -msg or -trace, instead of stdoutExport keying material using labelExport len bytes of keying material; default 20Enable security debug messagesOutput more security debug outputShow trace output of protocol messagesDo not use interactive command lettersSet TLS extension servername (SNI) in ClientHello (default)Do not send the server name (SNI) extension in the ClientHelloHex dump of all TLS extensions receivedDo not treat lack of close_notify from a peer as an errorRequest certificate status from servertypes Send empty ClientHello extensions (comma-separated numbers)Enable ALPN extension, considering named protocols supported (comma-separated list)Support asynchronous operationProtocol and version options: Enable send/receive timeout on DTLS connectionsEnable NPN extension, considering named protocols supported (comma-separated list)Enable post-handshake-authenticationEnable raw public keys (RFC7250) from the serverEnable raw public keys (RFC7250) from the clientOffer SRTP key management with a colon-separated profile list(deprecated) SRP authentication for 'user'(deprecated) Password for 'user'(deprecated) SRP username into second ClientHello message(deprecated) Tolerate other than the known g N values.(deprecated) Minimal length in bits for NDisable SSL/TLS compression (default)Disable sending TLSv1.3 compressed certificatesDisable receiving TLSv1.3 compressed certificatesDisable use of TLS session ticketsUse server's cipher preferencesEnable use of legacy renegotiation (dangerous)Allow client-initiated renegotiationAllow initial connection to servers that don't support RIDisallow session resumption on renegotiationDisallow initial connection to servers that don't support RIIn TLSv1.3 allow non-(ec)dhe based key exchange on resumptionIn TLSv1.3 prefer non-(ec)dhe over (ec)dhe-based key exchange on resumptionPrioritize ChaCha ciphers when preferred by clientsEnforce strict certificate checks as per TLS standardSignature algorithms to support (colon-separated list)Signature algorithms to support for client certificate authentication (colon-separated list)Groups to advertise (colon-separated list)Elliptic curve used for ECDHE (server-side only)Specify TLSv1.2 and below cipher list to be usedSpecify TLSv1.3 ciphersuites to be usedSpecify the minimum protocol version to be usedSpecify the maximum protocol version to be usedBlock size to pad TLS 1.3 records to.Perform all sorts of protocol violations for testing purposesDisable TLSv1.3 middlebox compat modeDisable Encrypt-then-Mac extensionDisable Extended master secret extensionDownload CRL from distribution pointsCRL format (PEM or DER); default PEMClose connection on verification errorRestrict verify output to errorsCA file for certificate chain (PEM format)Use dir as certificate store path to build CA certificate chainCA store URI for certificate chainCA file for certificate verification (PEM format)Use dir as certificate store path to verify CA certificateCA store URI for certificate verificationExtended certificate options: cert for Extended certificateschain for Extended certificatesbuild certificate chain for the extended certificatesformat of Extended certificate (PEM/DER/P12); has no effectformat of Extended certificate's key (DER/PEM/P12); has no effectWhere to connect; same as -connect option%4ld items in the session cache %4ld client connects (SSL_connect()) %4ld client renegotiates (SSL_connect()) %4ld client connects that finished %4ld server accepts (SSL_accept()) %4ld server renegotiates (SSL_accept()) %4ld server accepts that finished %4ld cache full overflows (%ld allowed) Error setting session id context Error clearing SSL connection Error waiting for client response HTTP/1.0 200 ok Content-type: text/html Ciphers supported in s_server binary --- Ciphers common between both SSL end points: no client certificate available HTTP/1.0 200 ok Content-type: text/plain Error opening '%s' mode='%s' '%s' is an invalid file name cert_status: Cannot open OCSP response file cert_status: Error reading OCSP response cert_status: can't parse AIA URL cert_status: no AIA and no default responder URL cert_status: Can't retrieve issuer certificate. cert_status: error querying responder cert_status: ocsp response sent: Error: client did not send PSK identity PSK warning: client identity not what we expected (got '%s' expected '%s') ALPN protocols advertised by the client: Out of memory adding to external cache Unexpected session encoding length New session added to external cache %s: -port argument malformed or ambiguous %s: -accept argument malformed or ambiguous verify depth is %d, must return a certificate Error parsing -status_url argument Invalid value for max_early_data Invalid value for recv_max_early_data Can't use -HTTP, -www or -WWW with DTLS Can only use -listen with DTLS Can only use --stateless with TLS Can't use -early_data in combination with -rev server certificate private keysecond server certificate private keysecond certificate private keysecond server certificate chainwarning: id_prefix is too long, only one new session will be possible Setting secondary ctx parameters Using default temp DH parameters Error setting temp DH parameters PSK key given, setting server callback PSK warning: there is NO identity hint in TLSv1.3 error setting PSK identity hint to context error setting session id context Error compressing certs on ctx Error compressing certs on ctx2 Configure SSL_CTX using the given configuration valueTCP/IP port to listen on for connections (default is 4433)TCP/IP optional host and port to listen on for connections (default is *:4433)Unix domain socket to accept onFor -unix, unlink existing socket firstDo not load certificates from the default certificates store URIDon't use any certificates (Anon-DH)Turn on peer certificate verification, must have a certServer certificate file to use; default server.pemCertificate file to use for servername; default server2.pemServer certificate file format (PEM/DER/P12); has no effectServer certificate chain file in PEM formatBuild server certificate chainPEM serverinfo file for certificatePrivate key file to use; default is -cert file or elseserver.pem-Private Key file to use for servername if not in -cert2Second server certificate file to use (usually for DSA)Second server certificate file format (PEM/DER/P12); has no effectsecond server certificate chain file in PEM formatSecond private key file to use (usually for DSA)Second key file format (ENGINE, other values ignored)Second private key and cert file pass phrase sourceServername for HostName TLS extensionOn servername mismatch send fatal alert (default warning alert)Test with the non-blocking test bioDisable caching and tickets if ephemeral (EC)DH is usedRespond to a 'GET /' with a status pageRespond to a 'GET with the file ./pathLike -WWW but ./path includes HTTP headersGenerate SSL/TLS session IDs prefixed by argCRL file format (PEM or DER); default PEMDownload CRLs from distribution points in certificate CDP entriesuse dir as certificate store path to build CA certificate chainuse URI as certificate store to build CA certificate chainuse dir as certificate store path to verify CA certificateuse URI as certificate store to verify CA certificateDisable internal cache, set up and use external cacheNo verify output except verify errorsIgnore input EOF (default when -quiet)Print more output in certificate status callbackStatus request responder timeoutFile containing DER encoded OCSP ResponsePrint output from SSL/TLS security frameworkPrint more output from SSL/TLS security frameworkact as an echo server that sends back received text reversedTerminate after #num connections(deprecated) The verifier file for SRP(deprecated) A seed string for a default user saltThe maximum number of bytes of early data as advertised in ticketsThe maximum number of bytes of early data (hard limit)The number of TLSv1.3 session tickets that a server will automatically issueSwitch on anti-replay protection (default)Switch off anti-replay protectionopening files in binary mode when acting as http server (-WWW and -HTTP)Disable TLS Extension CA NamesListen for a DTLS ClientHello with a cookie and then connectSet the advertised protocols for the NPN extension (comma-separated list)Set the advertised protocols for the ALPN extension (comma-separated list)Collecting connection statistics for %d seconds %d connections in %.2fs; %.2f connections/user sec, bytes read %ld %d connections in %ld real seconds, %ld bytes read per connection Now timing with session id reuse.0 connections in %ld real seconds Where to connect as post:port (default is localhost:4433)TLSv1.2 and below cipher list to be usedTurn on peer certificate verification, set depthSeconds to collect data, default 30Fetch specified page from the siteCert file to use, PEM format assumedFile with key, PEM; default is -cert fileOutput format - default PEM (PEM, DER or NSS)Don't output the encoded session infoEither -skeymgmt -or -cipher option should be specified Error creating opaque key for skeymgmt %s An opaque key identified by %s is created Key generation is the only supported operation as of now Key options as opt:value for opaque keys handlingSymmetric key management name for opaque keys handlingGenerate an opaque symmetric keyThe cipher to generate key for%s: Cannot use -%s together with -%s %s: Must have -signer before -inkey No operation (-encrypt|-sign|...) specified Error allocating PKCS7 object Bad input format for PKCS#7 file Error creating PKCS#7 structure Error decrypting PKCS#7 structure Bad output format for PKCS#7 file Digest algorithm to use when signing or resigningDon't translate message to textDon't include signers certificate when signingVerification/Decryption options: Recipient certificate file for decryptionset PKCS7_NOCHAIN so certificates contained in the message are not used as untrusted CAsRecipient certs, used when encryptingSIG verify failure at count %d Couldn't set input text length Couldn't insert AAD when encrypting Couldn't set cipher text length Couldn't insert AAD when decrypting Doing %s ops for %ds on %d size blocks: Doing %u bits %s %s ops for %ds: Too many fds in ASYNC_WAIT_CTX Error: max_fd (%d) must be smaller than FD_SETSIZE (%d). Decrease the value of async_jobs WARNING: the error queue contains previous unhandled errors. Unhandled error in the error queue during EC key setup. %ld %u bits private RSA sign ops in %.2fs %ld %u bits public RSA verify ops in %.2fs %ld %u bits public RSA encrypt ops in %.2fs %ld %u bits private RSA decrypt ops in %.2fs %ld %u bits DSA sign ops in %.2fs %ld %u bits DSA verify ops in %.2fs %ld %u bits ECDSA sign ops in %.2fs %ld %u bits ECDSA verify ops in %.2fs %ld %u-bits ECDH ops in %.2fs %ld %u bits %s sign ops in %.2fs %ld %u bits %s verify ops in %.2fs %ld %u-bits FFDH ops in %.2fs %ld %s KEM keygen ops in %.2fs %ld %s KEM encaps ops in %.2fs %ld %s KEM decaps ops in %.2fs %ld %s signature keygen ops in %.2fs %ld %s signature sign ops in %.2fs %ld %s signature verify ops in %.2fs %s: -evp option cannot be used more than once %s: %s is an unknown cipher or digest %s: async_jobs specified but async not supported Too many KEMs registered. Change MAX_KEM_NUM. Too many signatures registered. Change MAX_SIG_NUM. -aead can be used only with an AEAD cipher -mb can be used only with a multi-block capable cipher %s is not a multi-block capable Async mode is not supported with -mbError creating the ASYNC job pool Error creating the ASYNC_WAIT_CTX Don't understand line '%s' from child %d Unknown type '%s' from child %d Waitng for child failed with 0x%x Child terminated by signal %d You have chosen to measure elapsed time instead of user CPU time. Requested encryption length not a multiple of block size for %s! failed to allocate cipher context failed to initialise cipher context Impossible negative key length: %d failed to generate random cipher key The 'numbers' are in 1000s of bytes per second processed. Failed to to encrypt the data Failed finalize the encryption Failed initializing the context Requested CMAC cipher with unsupported key length. ECDH computations don't match. EdDSA verify failure. No EdDSA verify will be done. SM2 verify failure. No SM2 verify will be done. Error while initialising EVP_PKEY (out of memory?). Error while allocating EVP_PKEY_CTX. Error while initialising EVP_PKEY_CTX. Error setting DH key size for keygen. FFDH derivation context init failure. Assigning peer key for derivation failed. Checking size of shared secret failed. Assertion failure: shared secret too large. Shared secret derive failure. FFDH computations don't match. Error initializing keygen ctx for %s. Error while generating KEM EVP_PKEY. Error while initializing encaps data structs for %s. MemAlloc error in encaps for %s. Error while initializing decaps data structs for %s. MemAlloc failure in decaps for %s. Error initializing classic keygen ctx for %s. Error while generating signature EVP_PKEY for %s. Error while initializing signing ctx for %s. Error while initializing signing data structs for %s. Error while initializing padding for %s. Error while obtaining signature buffer length for %s. MemAlloc error in sign for %s. Error while initializing verify ctx for %s. Error while initializing verify data structs for %s. The 'numbers' are in 1000s of bytes per second processed.failed to get name of cipher '%s' %19ssign verify encrypt decrypt sign/s verify/s encr./s decr./s rsa %5u bits %8.6fs %8.6fs %8.6fs %8.6fs %8.1f %8.1f %8.1f %8.1f %18ssign verify sign/s verify/s dsa %4u bits %8.6fs %8.6fs %8.1f %8.1f %30ssign verify sign/s verify/s %4u bits ecdsa (%s) %8.4fs %8.4fs %8.1f %8.1f %4u bits ecdh (%s) %8.4fs %8.1f %4u bits EdDSA (%s) %8.4fs %8.4fs %8.1f %8.1f %4u bits SM2 (%s) %8.4fs %8.4fs %8.1f %8.1f %31skeygen encaps decaps keygens/s encaps/s decaps/s %27s %8.6fs %8.6fs %8.6fs %9.1f %9.1f %9.1f %31skeygen signs verify keygens/s sign/s verify/s RSA decrypt setup failure. No RSA decrypt will be done. RSA encrypt setup failure. No RSA encrypt will be done. RSA verify setup failure. No RSA verify will be done. RSA sign setup failure. No RSA sign will be done. DSA verify setup failure. No DSA verify will be done. DSA sign setup failure. No DSA sign will be done. ECDSA verify setup failure. No ECDSA verify will be done. ECDSA sign setup failure. No ECDSA sign will be done. EdDSA sign failure. No EdDSA sign will be done. SM2 sign failure. No SM2 sign will be done. Usage: %s [options] [algorithm...] All +int options consider prefix '0' as base-8 input, prefix '0x'/'0X' as base-16 input. Enable (tls1>=1) multi-block mode on EVP-named cipherProduce machine readable outputEnable async mode and start specified number of jobsSpecify number of primes (for RSA only)Lock memory for better result determinismRun the speed command in test modeUse EVP-named cipher or digestTime decryption instead of encryption (only EVP)Benchmark EVP-named AEAD cipher in TLS-like sequenceBenchmark signature algorithmsUse wall-clock time instead of CPU user time as divisorRun benchmarks for specified amount of secondsRun [non-PKI] benchmarks on custom-sized bufferUse specified offset to mis-align buffersAlgorithm(s) to test (optional; otherwise tests all)Specify the name of an SPKAC-dedicated section of configurationCreate SPKAC using private keySign new SPKAC with the specified digest (default: MD5)Validating user="%s" srp_verifier="%s" srp_usersalt="%s" g="%s" N="%s" assertion failed: srp_usersalt != NULLInternal error validating SRP verifier Creating user="%s" g="%s" N="%s" Internal error creating SRP verifier gNid=%s salt ="%s" verifier ="%s" %s: Only one of -add/-delete/-modify/-list -srpvfile and -configfile cannot be specified together. Exactly one of the options -add, -delete, -modify -list must be specified. -passin, -passout arguments only valid with one user. trying to read default_srp in srp trying to read srpvfile in section "%s" Trying to read SRP verifier file "%s" No g and N value for index "%s" Database has no g N information. user "%s" does not exist, ignored. t Cannot create srp verifier for user "%s", operation abandoned . user "%s" does not exist, operation ignored. user "%s" already updated, operation ignored. Verifying password for user "%s" Invalid password for user "%s", operation abandoned. Cannot create srp verifier for user "%s", operation abandoned. user "%s" does not exist, operation ignored. t SRP terminating with code %d. Usage: %s [options] [user...] The particular srp definition to useModify the SRP verifier of an existing userDelete user from verifier fileSet g and N values to be used for new verifierAdditional info to be set for userUsername(s) to process (optional)%s: the store scheme doesn't support the given search criteria. ERROR: OSSL_STORE_load() returned NULL without eof or error indications This is an error in the loader %s: only one search type can be given. %s: serial number already given. %s: can't parse serial number argument. %s: fingerprint already given. %s: can't parse fingerprint argument. %s: can't parse alias argument. %s: both -issuer and -serial must be given. Search by issuer and serial, issuer nameSearch by issuer and serial, serial numberSearch by public key fingerprint, given in hexPrint a text form of the objectsbad digest, %d bytes must be specified Warning: could not open file %s for reading, using serial number: 1 unable to load number from %s Error during serial number generation.could not save serial number to %s %s: Must give only one of -query, -reply, or -verify %s: Must give one of -query, -reply, or -verify openssl ts -query [-rand file...] [-config file] [-data file] [-digest hexstring] [-tspolicy oid] [-no_nonce] [-cert] [-in file] [-out file] [-text] openssl ts -reply [-config file] [-section tsa_section] [-queryfile file] [-passin password] [-signer tsa_cert.pem] [-inkey private_key.pem] [-chain certs_file.pem] [-tspolicy oid] [-in file] [-token_in] [-out file] [-token_out] openssl ts -verify -CApath dir -CAfile root-cert.pem -CAstore uri -untrusted extra-certs.pem [-data file] [-digest hexstring] [-queryfile request.tsq] -in response.tsr [-token_in] ...Section to use within config fileFile with private key for reply%serror %d at %d depth lookup: %s error %s: X.509 store context allocation failed error %s: X.509 store context initialization failed error %s: verification failed Recognized certificate chain purposes: Recognized certificate policy names: %s: Cannot use -trusted with -CAfile, -CApath or -CAstore Print extra information about the operations being performed.A file of trusted certificatesA directory of files with trusted certificatesURI to a store of trusted certificatesDo not load the default trusted certificates fileDo not load trusted certificates from the default directoryDo not load trusted certificates from the default certificates storeA file of untrusted certificatesFile containing one or more CRL's (in PEM format) to loadTry downloading CRL information for certificates via their CDP entriesDisplay information about the certificate chainCertificate(s) to verify (optional; stdin used otherwise)Show some internal datatype optionsError with certificate - error %d at depth %d %s Error while verifying certificate request self-signature Certificate request self-signature did not match the contents Invalid extension copy option: %s %s: Invalid trust object value %s %s: Invalid reject object value %s Cannot use -preserve_dates with -not_before option Cannot use -preserve_dates with -not_after option Cannot use -preserve_dates with -days option The -in option cannot be used with -new The -req option cannot be used with -new The -new option requires a subject to be set using -subj The -new option requires using the -key or -force_pubkey option Cannot use both -key/-signkey and -CA option Warning: ignoring -CAkey option since -CA option is not given Warning: ignoring -CAkeyform option since -CA option is not given Warning: ignoring -CAform option since -CA option is not given Warning: ignoring -CAserial option since -CA option is not given Warning: ignoring -CAcreateserial option since -CA option is not given Warning: ignoring -extensions option without -extfile Error checking extension section %s Warning: Reading cert request from stdin since no -in option is given Error unpacking public key from CSR Certificate request self-signature ok Warning: ignoring -copy_extensions since neither -x509toreq nor -req is given Warning: ignoring -preserve_dates option with -req or -new We need a private key to sign with, use -key or -CAkey or -CA with private key Must not use -clrext together with -copy_extensions Warning: Reading certificate from stdin since no -in or -new option is given Warning: Ignoring -ext since -clrext is given Serial number increment failure Error adding extensions from section %s Must specify request signing key using -key Warning: -ext should not specify copying %s extension to CSR; ignoring this Error copying extensions from certificate No modulus for this public key typeNo extensions matched with %s Bad output format specified for outfile Certificate input, or CSR input file with -req (default stdin)Private key and cert file pass-phrase sourceGenerate a certificate from scratchOutput a certification request (rather than a certificate)Input is a CSR file (rather than a certificate)copy extensions when converting from CSR to x509 or vice versaCSR verification parameter in n:v formKey for signing, and to include unless using -force_pubkeyOutput format (DER or PEM) - default PEMNo cert output (except for requested printing)No output (except for requested printing)Certificate printing options: Print the certificate in text formVarious certificate text printing optionsPrint the certificate fingerprintPrint both notBefore and notAfter fieldsSynonym for -subject_hash (for backward compat)Print old-style (MD5) subject hash valuePrint old-style (MD5) issuer hash valueRestrict which X.509 extensions to print and/or copyPrint OCSP hash values for the subject name and public keyPrint out certificate purposesPrint the public key in PEM formatCertificate checking options: Check whether cert expires in the next arg secondsExit 1 (failure) if so, 0 if notCheck certificate matches hostCheck certificate matches emailCheck certificate matches ipaddrSerial number to use, overrides -CAserialIncrement current certificate serial numberNumber of days until newly generated certificate expires - default 30Preserve existing validity datesSet or override certificate issuerSet or override certificate subject (and issuer)Key to be placed in new certificate or certificate requestDo not take over any extensions from the source certificate or requestConfig file with X509V3 extensions to addSection of extfile to use - default: unnamed sectionSignature parameter, in n:v formCorrupt last byte of certificate signature (for test)Any supported digest, used for signing and printingUse the given CA certificate, conflicts with -keyCA cert format (PEM/DER/P12); has no effectThe corresponding CA key; default is -CA argCA key format (ENGINE, other values ignored)File that keeps track of CA-generated serial numberCreate CA serial number file if it does not existCertificate trust output options: Mark certificate PEM output as trustedSet certificate alias (nickname)Trust certificate for a given purposeClears all the prohibited or rejected uses of the certificateReject certificate for a given purposeFailed to create null provider Failed to create library context unknown type (%u) of %zu bytes %s: unable to load provider %s Hint: use -provider-path option or OPENSSL_MODULES environment variable. %s: malformed '-provparam' option value: '%s' %s: Error setting provider '%s' parameter '%s' %s: No provider named '%s' is loaded error: setting distinguishing ID in certificate failed error: setting distinguishing ID in certificate signing request failed Server did not accept our TLS certificate, likely due to mismatch with server's trust anchor or missing revocation statusThe server does not support HTTPSThe server does not support (a suitable version of) TLSTLS handshake failure. Possibly the server requires our TLS certificate but did not receive itCannot authenticate server via its TLS certificate, likely due to mismatch with our trusted TLS certs or missing revocation statusproblem loading oid section %s problem creating object %s=%s %s: Could not allocate %zu bytes for %s static unsigned char %s_%d[] = {error converting serial to ASN.1 format Error creating random number to store in %s Unable to load number from %s Error converting number from bin to BIGNUM Error creating serial number index:(%ld,%ld,%ld) Error creating name index:(%ld,%ld,%ld) %s: %s name is expected to be in the format /type0=value0/type1=value1/type2=... where characters may be escaped by \. This name is not in that format: '%s' %s: Error copying %s name input %s: Missing '=' after RDN type string '%s' in %s name string %s: Escape character at end of %s name string %s warning: Skipping unknown %s name attribute "%s" %s hint: a '+' in a value string needs be escaped using '\' else a new member of a multi-valued RDN is expected %s warning: No value provided for %s name attribute "%s", skipped %s: Error adding %s name attribute "/%s=%s" Hostname %s does%s match certificate Email %s does%s match certificate IP %s does%s match certificate SSL_CTX given but use_ssl == 0Error configuring OpenSSL modules Can't access file descriptor %s Invalid password argument, missing ':' within the first %d chars Invalid password argument, starting with "%.*s" Error reading password from BIO Error getting password for %s Trying plain input string (better precede with 'pass:') Out of memory getting password for %s Internal error: nothing was requested to load from %s No filename or uri specified for loading Could not open file or uri for loadingLoading %s over HTTPS is unsupported Unable to load %s from %s (unexpected parameters type) error: HTTP retrieval not allowed for %s Warning: certificate from '%s' with subject '%s' %s assertion failed: mode == 'a' || mode == 'r' || mode == 'w'error: unable to load %s from file '%s' Warning: error while verifying CSR self-signature Warning: CSR self-signature does not match the contents %s: Can't open "%s" for writing, %s Error writing to output file: '%s' %s is invalid, it should be "today" or have format [CC]YYMMDDHHMMSSZ Error setting notBefore certificate field Error setting notAfter certificate field %s: end date before start date Warning: generating random key material may take a long time if the system has a poor entropy source Warning: generating random key parameters may take a long time if the system has a poor entropy source %s: Generating %s key parameters failed OpenSSL application user interfaceCould not allocate %d bytes for %s No engine specified for loading %s No engine key id specified for loading %s error detaching from parent process group: %sinternal error: no matching child slot for pid: %ldchild process: %ld, exit status: %dchild process: %ld, term signal %d%sinternal error: no free child slotserror setting accept on port %sHTTP/1.0 200 OK %sContent-type: %s Content-Length: %d sending response, 1st line: %.*sawaiting new connection on port %s ...cannot parse HTTP header: missing end of lineinvalid %s -- URL does not begin with '/': %sinvalid %s -- bad HTTP/version string: %sinvalid %s request -- bad URL encoding: %scould not allocate base64 bio with size = %dHTTP request does not begin with %sPOST: %serror parsing HTTP header: missing end of lineerror parsing HTTP header: missing ':'error parsing DER-encoded request contentout of memory allocating %zu bytesreceived request, 1st line: %s%s: Bad format "%s"; must be one of: %s: Unknown option or cipher: %s %s: AEAD ciphers not supported %s: Unknown option or message digest: %s %s: Can't parse "%s" as %s number %s: Can't parse "%s" as a number %s: Value "%s" outside integer range assertion failed: unknown_name != NULLassertion failed: unknown == NULLassertion failed: unknown->valtype == 0 || unknown->valtype == '-'assertion failed: opt > OPT_V__FIRSTassertion failed: opt < OPT_V__LAST%s: Internal error adding Policy %s %s: Internal error setting purpose %s %s: Extra argument after %s: "%s" %s: Extra (unknown) options: "%s" "%s" %s: Option -%s does not take a value %s: Non-positive number "%s" for option -%s %s: Negative number "%s" for option -%s %s: Invalid format "%s" for option -%s %s: Multiple %s or unknown options: -%s and -%s s_cb.c:security_callback_debug op=0x%xKeylog callback is invoked without valid file! Checking cert chain %d: Subject: %s: %zu-byte buffer too large to hexencode unable to get certificate from '%s' unable to get private key from '%s' Private key does not match the certificate public key error setting certificate chain error building certificate chain Supported Elliptic Curve Point Formats: read from %p [%p] (%zu bytes => %zu (0x%zX)) read from %p [%p] (%zu bytes => %d) write to %p [%p] (%zu bytes => %zu (0x%zX)) write to %p [%p] (%zu bytes => %d) Not TLS data or unknown version (version=%d, content_type=%d)TLS %s extension "%s" (id=%d), len=%d error setting random cookie secret Error calculating HMAC-SHA1 of buffer with secret matched the peer raw public key No peer certificate or raw public key Call to SSL_CONF_cmd(%s, %s) failed # SSL/TLS secrets log file, generated by OpenSSL --- No %s certificate CA names sent --- Acceptable %s certificate CA names Secure Renegotiation IS%s supported This TLS version forbids renegotiation. application layer protocol negotiation bad_certificate_status_responseassertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(ai)) && (type == 0 || type == BIO_ADDRINFO_socktype(ai)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(ai))Can't bind %saddress for %s%s%s assertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(res)) && (type == 0 || type == BIO_ADDRINFO_socktype(res)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(res))SRP param N and g are not known params, going to check deeper. SRP parameters set: username = "%s" info="%s" Failed to initialize SRP verifier file Cannot initialize SRP verifier file "%s":ret=%d pB0BBPBBБBXB0BBB8B(BBBؒBBB0BM-&J8J-=JRJ<VJM-tJJAJJ<JJ>JJJJpJJ pJJ pJM0JJ sXJJsJ JJJsJM3JM-NJcJeJxJ }JJ pJ0123456789ABCDEFYJeJsJJJJJJJJJ M-0JM-&J8J-=JJ-XJJ5-JJ/JJ<JJFJJ*-JJ>J!Js(J)J-xJ0J-6JT J"-JJJ+<JRJ,<JXJs@JM-_JwJs~JJshJJsJRJsJM-JJsJD J-JJ-J_J4- JJ -PJJ sJ J(sJ,J sJ4J)s>JTJ pJJ/s@JYJ0<xJaJ-lJJ -JM-JJ sJJsJJfJJsJJs@JJ<JJFJJ-JJsJJsJM-J3J!-:JMJ.s@JSJ1sJZJ2-cJJ3sJJFs JJGsJJHs0JJIsxJJ#sJJ$sJJ%pPJJ&ppJJ'pJJ-<JM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JJJ M-JM-&J8J-=JM-JJ -hJJ -!J3J-;JVJsJM-J^J-`JwJ-|JJ-JJ-JJ-JJ -8JJ -`JJ sJM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JJJ vCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvC0uCvCvCvCvCvCvCvCvCvCvCvCvCvCvC0uC vCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvCvC vCvC vCvC vCvCvC0uCڄCфCȄCChCCsave_free_certsprint_statusprint_itavssave_keyspecdelete_fileprint_keyspecsave_templatesave_crldo_genmhandle_opt_geninfoset_nameset_gennamesset_fallback_pubkeysetup_request_ctxsetup_protection_ctxsetup_ssl_ctxsetup_verification_ctxtransform_optswrite_PKIMESSAGEread_PKIMESSAGEread_write_req_respsetup_client_ctxcmp_serversetup_srv_ctxopt_strget_optsset_verbosityread_configprev_itemcmp_mainNXENPENNNNN(N NNNNNNxNpNhN`NXNPNHNKJ&sx>K#J'N>K.J(N?K:J)N`?KM-?KHJ*s?KMPJiJ+s@KsJ,s`@K{J-s@KJ.-AKJ/-PAKMAKMAKJ0-8BKJ1sBKJ2sBKJ3sCKJ4shCKJ5sCKJ6sCKJ7s@DKJ8sDKJ9sDKJ:sEKM-8EK&J;sXEK*J<sEKJ=sEKM8FKMxFK1J>sFKJ?sFK=J@s0GKEJAspGKLJBsGKPJCsHKMXHK[JD-HKM-pJJEsHKJFs(IKJGspIKJHsIKXJIsIKM@JKM-=JPJBsJ^JAs`JgJDsJqJCsJM-J.JsJ3J>JM-JJ-JKJsJKJsKKJsHKKJsKKJsKKM LKJsHLKM-LK0J-LKJpMKJsHMK J-MKJsMKJsNK+JsHNK1JsNK8J-NKM-EJ[JsOK`JNHOKiJsOKqJsOK|JsJJs8PKJspPKJsPKJsPKJs QKJshQKJsQKMQKJs(RKJs`RKJsRK JsRKJsSK$JsPSK3JsSKBJNSKMJN(TKYJ-pTKlJNTKvJNTK~JN@UKJ sUKJ -UKJ -UKJ -(VKMxVKMVKJ -WKJ-8WKJ-hWKM-JRJsWKJsJ1Js=JVJncJuJnWKJMJJsJJsJJsJ J-WK J-( J5 J-XK? J-M Ji J-v J J-@XK J-pXK J-XK J-XK J- J J- J !J-XK!J-&!JD!J- YKR!J-b!J|!J-HYK!J-!J!J-YK!J-( J!J-YK!J-YKmock server   M-_K8J-=JM-&JJ<$JJ>$JwJF<_KM-$J$J-%J%J-%J3%J-8%JE%J -L%Jb%J -i%J%J -_K%J<`KEJs@`K%J-p`K%J-`K%J-`K%J-`K%J-(aK%J-`aK%J-&J &J-aK)&J-0&JM-E&JJcaK[&JcaKc&J/Fk&J&J(-&J&J(-&J&J)-&J&J#- bK&J*-`bK&J-bKM-&J'J<sbK'J:sbK'J;s(cK)'JFshcKJ>s/'JM'JHscKJGfcKXJPscKM-=JPJBsJ^JAs`JgJDsJqJCsJM-J.JsJ3J>JM-(dKT'Js_'J{'JC<'J'J.PdKJ-dK'JOsdK'JK-'J'JL-'J'JM-'J (JN-(J.(J-eKM-JJEs<(JT(JBs[(Jy(J0<HeKMeK(J -eK(J -(J(J-fK(J-HfK(J!-pfK(J"-fK(J--fK(J.-fK(JIs8gK )JJsxgKM- )JT(JsgK7)J7<gK?)J&-hKQ)J'-8hK`)J%-hhKg)J-hKp)J-hK(J-hKy)J -iK)J1<)J)J2/0iK)J3:PiK)J5-piK)J4-iK)J6-iKM-J)J$-)J)J=s*J*J-(jK$*JD>-*JE*J?sH*JS*J@sX*J JAse*JM-m*JJ+-PjK*J8-jK*J9sjK*J,-*JM-JRJsWKJsJ1Js=JVJncJuJnWKJMJJsJJsJJsJ J-WK J-( J5 J-XK? J-M Ji J-v J J-@XK J-pXK J-XK J-XK J- J J- J !J-XK!J-&!JD!J- YKR!J-b!J|!J-HYK!J-!J!J-YK!J-( J!J-YK!J-YKM-&J8J-=JE%J-+JM-+JJ<+JJFkKJ<kKJFkKM-JJ>,J[&JF3,J!Js(J*J- lKO,J-T,Je,J-@lK*JshlKJ-n,JM-,JJ-,J,J -,J,J -,JJ-,J,J -,JJ --J&-J -lK--J<lKM-J)J/mK)J<0mK)J:`mK)J-piK)J-iK)J-iKM-=JPJBsJ^JAs`JgJDsJqJCsJM-&J8J-=JM-+JJ<$JJF-J-J-mKy(J<mKM-JJ>$J[&JF-JM-=JPJBsJ^JAs`JgJDsJqJCsJ M-oKM-&J8J-=Jr/J-w/JXJ scK/J -oKJs/'JM-J/J-pK6 J-0pKJ>XpKJ fpK/J-/J&J-/J/JppK/J-/JHJ-/JM-J3%Js/JE%JsHqK/J spqKJsJ/J <0J&0Js+0JLJsqKF0JsqKJ-n,JM0J-qKM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJM-{J^0J0rK M-tKM-&J8J-=Jz0J-0J0J -uKXJscKM-+JJ<$JJF0JM-JJ>$J[&JF0J*J-HuKJ -puK0J -uK0J -uK0J -vKJ-0JJ-0JM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJM-{J0J8vKM-&J8J-=JJ-1J2J -vK2J-wK%2J-.2JXJscKM-+JJsI2JJf(wKS2J -XwKJs/'JM-JJ>$J[&JfY2JJ -t2J*J -2J2J -2J2J-wK2JswKM-=JPJBsJ^JAs`JgJDsJqJCsJ M-yKM-&J8J-=JXJ scKM-+JJ<$JJF-JM-JJ>$J[&JF-J*J-2JJ-3JJ -0JJ -0J3J-3JM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJM-{J0J(zK,3JhzKM-&J8J-=JXJs@JM-+JJs$JJf`{KS2J -XwKJ s/'Jz0J-3JJ-1J3Js{K 4Js{KM-JJ>$J[&JF-JJ-t2J*J-4J!4J -{K2J -wK+4J-|K2J swKM-=JPJBsJ^JAs`JgJDsJqJCsJM-&J8J-=Jp5J-@}KXJs@J3J-|5JJ<5JJFp}KJ>5J[&JF3,JM-J*J-}KJ -5J3J s{KM-5Jz0J-5J6J-}K6J -~KJ s8~K 4J s{KM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJSalted__M-&J8J-=Jr/J-j8Jw8J-8J8J-8J/J-8Jc0J -8J8J-8JXJs@JM-+JJ<$J8Js8J8J<8JM-JJ>$J8Js9JJ -0J9J-K56J-9J&9J-8KM-(9J=9J -xKC9J -H9Jf9J -m9JHJ-/J9Js9J9Js9J9Js9J9Js9JJsK9Jp؀KM9J9J-KMHK9J-9J9JpKM:J :JFsK:JGsKJ-1JM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJ M-KM-&J8J-=JG;J-KI;JsKM;Js KM-JJd-PKR;Je-KU;Jf-KY;Jg-K/J-K^;J-0KM`KM-{JXJa;J M-KM-&J8J-=JM-{J};J;JzDwD0{D {D|D|D|Dp|DX|D@|D{D{DwD}D}DwD}D}D}D}Dp}D`}DP}D@}D0}D }D}D}D|Dp~D`~DP~D@~D0~D ~D~D~D~D~D~D~D~D~D|D|D{D{D{D?M-&J8J-=J@J-XKE%J -K@J<K@Js AJAJs؆K>J-K>J-pK*AJ--K ?J.-؇K;AJ-KEAJ-RAJlAJ-HKAJ-KAJ-AJAJ-AJAJ-BJBJ-K5BJ-KKBJ-K_BJ-rBJBJ -(KBJ!-BJBJ"-HKBJ-hKBJ-KCJ-K+CJ#-:CJTCJ$-dCJCJ%-KCJ&-CJCJ'-CJCJ(-DJDJ)-.DJKDJ*-]DJ>J+-(KzDJ,-PKM-+JJ<pKM-JJ>KDJsDJF0J sȊKMKJ - KDJ sHKDJ sDJwJ<DJJ-DJ M-؋KM-&J8J-=JXJs@JM-JJ>K2JswKM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJJ-(KJ-0JJ-0JM-{J*EJXKFJ FJFJFJFJM-&J8J-=JXJs@JFJ<'FJ7FJsAFJJ -KJ -ȍKZFJsKwJ<_KM-JJ>bFJ|FJ>FJ[&JFFJ8JswKFJ -FJ*J -FJJ -0KM-=JPJBsJ^JAs`JgJDsJqJCsJM-J.JsJ3J>J MXK M-OGJM-&J8J-=JXJs@JM-+J0J-KlGJ-KoGJ-KM-JJ>K2JswKrGJpyGJJ -0JJ -0JGJF- KJ-(KM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJM-{J0JGJDPD@DDСDDDDDDpDM-&J8J-=JM-JGJ-HKGJ-pKHJ-K HJ-ȐKHJ-HJ;HJ-CHJ\HJ-bHJoHJ -{HJHJ -HJ M-BIJM-&J8J-=J`IJsKJsgIJEJsnIJLJsuIJM- KyIJsPKM-JJ>XpK&J-xKM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JIJIJMJMJJM-&J8J-=JM-J;J-MJJ-MJMJsMJMJ-MJNJ-MJ+NJ-:NJQNJ-KaNJ -KsNJ-KNJ-PKNJ-KNJ-KNJ -KNJ -KNJ-NJNJ-OJOJ-'OJXpK&J-xKM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JDJQJM-&J8J-=JM-+JJ<$JM-JQJ-QJJ>$JM-=JPJBsJ^JAs`JgJDsJqJCsJM-&J8J-=JUTJ -K)J!<)J)J"<0iK)J#:PiK)J$-piK)J%-iK)J&-iKM-`TJtTJpPK|TJ -KTJpKTJ-K&-J-KNJ1<2RJTJ2pXKTJ3pKJsKT(J<KTJ<KTJ0<TJTJ4p@KTJ5<hKTJ6<KJ;sKTJ7<KTJ8sKTJ9sPKTJ:sUJUJ<sKJ-KM- UJ1UJs5UJCUJsK[JNHUJJ,saUJJsKJs=KM=KJ>}UJg)J -UJUJ -UJUJ -XKUJ-xKUJ-KUJ-ОK*J-KVJ- VJ&VJ-0VJLVJ-UVJqVJ-KVJ-PKVJ-KVJ-KVJsKVJ<VJVJ <KJ.<HKkJ/sKVJ'uKVJ)sKJ*sKVJ+s0KJ-<VJ WJ(pWJM-JRJsWKJsJ1Js=JVJncJuJnWKJMJJsJJsJJsJ J-WK J-( J5 J-XK? J-M Ji J-v J J-@XK J-pXK J-XK J-XK J- J J- J !J-XK!J-&!JD!J- YKR!J-b!J|!J-HYK!J-!J!J-YK!J-( J!J-YK!J-YKM-=JPJBsJ^JAs`JgJDsJqJCsJ M-pKM-&J8J-=JM-{JWJKrounds= M- KM-&J8J-=JM-+JJ<;XJg)J-@Kl/J -TXJM-JJ-nXJzXJ-XJXJ-XJM-XJC9J sXJXJ -xK0J -KWJ-K;J-XJXJ -KM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JYJK$./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz]E^E^EP^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^E^Ex]E0aEXcEaE0dEbE`EM-&J8J-=JJ#<$JJ$>$JJ%s/'J2J&swKYJ'sKp\J -ЩKx\J-\J(J-\JJ -K_[JI-0KXJ.s@JM-=JPJBsJ^JAs`JgJDsJqJCsJM-J.JsJ3J>JM-pKJ -KZJ -\JZJ-ȪKZJ-\JJ-K\J-\J ]J-KM-@K]J-]J)'JshKy(J<KZJsKJ -KMKiJ<`K)J)<+]J)J(/C]J)J*:`]J)J,-piK)J+-iK)J--iKJ su]JZJ"sKZJ!s]JZJ-K[J-K [J-K[Js@K]JspK]J-K,[JsK]JG-0K]JHsXK9JpK]J-KD[J-]J]J-KT[Jp]JN[J-^J)^JFsKM-&J8J-=JXJ s@JM-+JJ<$JJF-JM-J[&JF-JJ>$JJ-O^J*J-K*J-Ki^J -دKJ -KM-=JPJBsJ^JAs`JgJDsJqJCsJM-&J8J-=JXJs@J[_Js^_Jy_Js|_J_JsPKM-+JJ<$JJF_JJs/'J_J -KM-JJ>$J[&JF_J_J-_J2JswKGJ-K9Jp_J]J-`J9JpаKMKM-'`J8`J -?`JT`J s]`Jt`J s}`J`J s`JM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJM-&J8J-=JXJs@JM-=JPJBsJ^JAs`JgJDsJqJCsJz0J-`J`J-aJM-+JJsI2JJf`KJs%aJS2J -KM-JJ>K[&JFKJ-K2JsHKGJ-pK2J -KJ -سK*J -KBaJ -(KKaJsXKXaJsKM-&J8J-=JXJs@Jz0J-aJM-+JJ<$JM-JJ>$J*J-aJJ-KM-=JPJBsJ^JAs`JgJDsJqJCsJM-&J8J-=JXJs@J/J-K3%J -KE%J -cJ$J-K%J-KcJ-8KcJF-cJcJG-cJwJJ<_KM-+JJ<+J)'JspKS2J-cJJs/'JdJsKdJEKdJ-K&dJ -K*dJ<8KJE`KM-JJ>5J*JH>K2dJ-KJM-=JPJBsJ^JAs`JgJDsJqJCsJ M-KM-&J8J-=JveJp{eJeJpeJM-J/J-eJeJ-eJeJ-KM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JeJK M-KM-&J8J-=JXJs@JM-JJ>$J56J-jJ/J-jJM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JjJjJ M-KM-&J8J-=JkJ-=JlJ-K J-KlJ- lJM-JJ-0JM-=JPJBsJ^JAs`JgJDsJqJCsJM-{J'lJ@K1lJ5lJ9lJeJJ6 JM-&J8J-=JJsKXJs@J;oJsKJ <0KJFJE%J-`KM-J J -IoJwJ <UoJJ2sKD J-K*JshlKkoJsroJ*J"-oJfJ#-KoJ$- KNJ%<PKoJ&sKMoJJ sK J!-KJ'-PJ J(sJ4J)sJTJ*p KoJ+soJ J,sHKJ-sxKOJ.soJpJ/sK pJ0-KM-pJJs@KJ fpK,pJ-3pJEpJ>LpJJsxK2JswK%JsKZFJs KJsJJsJJ1-n,JM-JJ >$J[&JF-J0J-KJ-0JJ3-0J\J-\J ]J-KJ-ipJ{pJ- K2J-pJM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJM-&J8J-=Jz0J-pJJ-1JXJs@JM-+JJs$JJf`{KS2J-XwKqJ -qJJ s/'JM-JJ>$J[&JfK2J-+qJ?qJ -PqJ2J swKJ-t2J*J-2J2J-jqJGJF- KM-qJ2J-vK2J-wK%2J -.2JM-=JPJBsJ^JAs`JgJDsJqJCsJM-&J8J-=J3%J -qJE%J -cJ$J-qJ%J-qJXJs@JM-+JJ<$J)'JsKJE`KS2J-KdJ-K&dJ -KJs/'JM-JJ>$JrJ-rJ+rJ -@K0rJ -5rJLrJ-QrJ2dJ-hKJM-=JPJBsJ^JAs`JgJDsJqJCsJFǍFSFFFQFQFFF]FFkFFBFF}FȎFXF,FFďFFFUF}FF}FFFyFFFFF F}FFFF[FMF"FFFFFFFFYFFFFFF8FӯFFFFFFFFFFFFFFFFFFFFFFFFFYF/ !...S{JX{J]{Jb{Jf{Jk{Jw{J~{J{J {J {J {J {J {J M-pKM-&J8J-=JXJ$s@J{JsK{J4sK{J -K{J -@K{J <{JM-{JCUJs{J[Jp{J|JshK|JsKJ sK|J sK*|J sK5|Js8K:|J-<|JXJ-J|JX|J]phKc|J^pq|J|J_pK|J`pK|Jap(K|J -|JM-|JJ <`KJFK|JB<K|JE-KJCsKJ@E@K8JAspKE%J pK*J shlK)JH/}J)JL<!}J)JP:`]J)JM-piK)JI-iK)JQ-iK9}Jd<KG}J sX}Jn}J sK}J -(K}J+s}JJ,s}J}J-<hKJ\sKM-}JzJD-K}J>}J ~J<~JM-1~JH~J-(KJ-M~J`~J-PKh~J-s~J~JUsxK~J sK~J-K~J-0K~J-hKM-~J~J(-KHJ-~J~J"-~J~J#>KJ)- JIJ*-&J;JZsKHJ[p0KXJ&-`KgJ'-K~J%-KJb>JJ -KJ -JJVsKJW-8KJ-xKJ -KSJ -KJTsKJGsPKJX-KJ-#JM-KwJ8-7JJ7-FJJ6-WJJ5-hJyJ9-~JJ<-JtTJ>-KJ?pJJ:-ŀJՀJ;-݀JJFsKJc<J"J -pK-J -K?J -KQJYsKZJ.sHKbJ/sxKjJ1-KwJ2-KJ0pKM-J.JsJ3J>JM-JJ -JJ -ȁJہJ -JJ -JJ -#J8J -=J[J -HKcJ -hJJ -pKJ -KJ -KJ -KJ - KЂJ -PKJ -JJ -xK'J -K>J -KWJ -(KhJ -hKzJ -KJ -KJ s(KJ s`KJ sKJ sK54J sKJ s(KJ s`KJ sKŃJ sK҃J sKJ -KJ -PKJ -xK J -KM-JRJsWKJsJ1Js=JVJncJuJnWKJMJJsJJsJJsJ J-WK J-( J5 J-XK? J-M Ji J-v J J-@XK J-pXK J-XK J-XK J- J J- J !J-XK!J-&!JD!J- YKR!J-b!J|!J-HYK!J-!J!J-YK!J-( J!J-YK!J-YK*J <J"J-K/JFK7J- KKJ-HKXJN<pKdJJ/KpJR:K}JO<KJK/@KJS:KM-KJ<JȄJ<K΄J<KՄJ-KJFHKJFKM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JJKFFFF8FFpF8F8FPFFxFFPFPFPFFpFxFxFFFLets print some clear text M-&J8J-=J{JTsxL~J@-JXJs@JM-{J[JpLJsL5|Js@L J-`L:|J-<|JXJ-J|JM-|JJ sJ)J)<!}J)J/}J)J-:`]J)J*-piK)J -iK)J.-L2J-LE%J nK9J nL*J shlKJ<0L@Ji<hLJFL|J<L|J(-LJs8LJs`LFJj<LJf@K8JspKKJ<LQJF L[J<hLgJ<LlJfLuJs LeJ<{JJgsH LJh-p LJ2- LH~JD-(KJE-JJH- LˌJP- LόJQ-8 LJ{-KJ6-xKӌJR-` L،Jfs L;JosKHJpp0K*J<J/J%F L"J- LXJ+<pKdJ!/8 LpJ/:x L}J,<KJ"/ LJ0: LJ#-JJ$-0 L7J&- KKJ'-h L`~J3- Lh~J4- JM-#JSJ7-K2J8- LAJ9n LPJ<s[JJ:sKJ;s=KM=KwJ=< LM-~JXJA-H LgJB-x L~JF-K&dJO- LHJ5-J~J>-~J~J?>KIJC-JJS-J|JWpKǍJ p LJq>JM-{JJ1-#JtTJb-ύJJcpߍJ|JXp(K|JVpKc|JUpq|JM-J}JIs J#JJs,JJKs}J}JL<hKEJM<LNJNs@LM-KZJrnxLiJsnLJt-}JJunLJv-HLJw-xLJy-LӎJz-LߎJe-JwJ]-JJ\-JJ[-#JJZ-5JyJ^-GJ\Jd-LJ_-cJՀJ`-tJQJnsKJG-JJksPLJlsL-J-K?J-KM-J.JsJ3J>JM-JJ -JJ -ȁJہJ -JJ -JJ -#J8J -=J[J -HKcJ -hJJ -pKJ -KJ -KJ -KJ - KЂJ -PKJ -JJ -xK'J -K>J -KWJ -(KhJ -hKzJ -KJ -KJ s(KJ s`KJ sKJ sK54J sKJ s(KJ s`KJ sKŃJ sK҃J sKJ -KJ -PKJ -xK J -KM-JRJsWKJsJ1Js=JVJncJuJnWKJMJJsJJsJJsJ J-WK J-( J5 J-XK? J-M Ji J-v J J-@XK J-pXK J-XK J-XK J- J J- J !J-XK!J-&!JD!J- YKR!J-b!J|!J-HYK!J-!J!J-YK!J-( J!J-YK!J-YKM-KJ<JȄJ<K΄J<KՄJ-KJFHKJFKM-=JPJBsJ^JAs`JgJDsJqJCsJM-&J8J-=JM-J|JsL J-*JDJ-JJ8J-=JJsHLJs`KwJ-eJJ-FJJ-WJJ-hJE%JpxLvJpLˌJsLM-J*JshlKJ<LJ<(L{J <!}J)J <!}J)J/}J)J :`]J)J -piK)J -iK)J -LM-=JPJBsJ^JAs`JgJDsJqJCsJGET %s HTTP/1.0 @@@?`7G7G9G@7G9G9G9G9G9Gp9G7GM-&J8J-=JJ sJM-+JJs+JJFp}KM-JJ>5J[&JfXL*J-0JJ-MJJ-LM-&J8J-=J :JGsL:JHsL3JI-LJFs(LM-=JPJBsJ^JAs`JgJDsJqJCsJ M-_KM-&J8J-=JJ<$JJcaKJ>$J[&JcaK)'JshcKJ fcKXJs@J&J-&J&J-&J&J-&JwJF<_KM-J$J-%J%J-%J3%J-8%Jb%J-i%JE%J-L%JJ-JM- JJs/'JJsLJ-1Jp)J -hK(J-(J(J -HfK&J-LT(Js&J7)J<gK(J -LM-L`)J-hhKg)J -hKy(J!<HeKMeK{'J<8LM->JE*JsH*JS*JsX*J Jse*J*J-(jK(J-pfKM-NJ)J#/0iK)J"<)J)J$:PiK)J%-piK)J&-iK)J'-iKjJ -hL&J-`bKM-J.JsJ3J>JM-JRJsWKJsJ1Js=JVJncJuJnWKJMJJsJJsJJsJ J-WK J-( J5 J-XK? J-M Ji J-v J J-@XK J-pXK J-XK J-XK J- J J- J !J-XK!J-&!JD!J- YKR!J-b!J|!J-HYK!J-!J!J-YK!J-( J!J-YK!J-YKM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JJL @aJfjJg sJh|JiJj N>`N`NN `N- @N @lN!<0123456789ab4Vx4VxVx4x4V4Vx4VxVx4This is a key...JҞJܞJJJJJ  JJJ$J-J;6J?JHJQJZJ;cJsJJJJJJ J ßJ?@˟J@rџJڟJJJJJJJJ"J +J 4J =J FJ OJXJaJnJ{JJJJJJàJ͠JנJJJJJ JJJ 'J 1J ;J EJ OJYJcJqJJJJJ$J+J3J;JCJKJSJJJfJfJ&0J {ZJfJfJxJJ@gJnJ4iJ diJ [iJ agJygJgJhJhJiJiJ?iJJơJʡJ ӡJ iJ5J!jJءJCiJejJFiJJJ.JJJ M-+LM-&J8J-=J J -(,L J-`,LTJpJ+J p,LXJs@JrGJGp,L6JL-,LJM-=JPJBsJ^JAs`JgJDsJqJCsJM-{J7FJ.L @@ @M-&J8J-=J}J s.LXJs@JM-+JJ<$JJ<(/LJ fJJ s/'JJ sJRJ sJM-JEJsH/LJ>$JJ-J,pJ-3pJE%J-ɣJM-=JPJBsJ^JAs`JgJDsJqJCsJ M- 4LM-&J8J-=JJ-JwJ<~JJs@4LXJs@JM-JJ-JΥJ-h4LեJ-4Lr/J -ܥJM-_JEJ<JJ s4LJ s4LJ s/'J2J swKM-J.JsJ3J>JM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JJ5LwHwHvHPvHuHHuHvH M-JM-&J8J-=JJ-n,JXJs@JM-JJ-J5J*J-7LJ-JM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JɧJͧJM-&J8J-=JwJ<}JJs;LXJs@J)'Js;LT(Js&JJ<J)J<J)J/ũJ)J:ީJiJ<J J -J,J-6JJs/'JJ-n,JM-NJ^J-dJN{J<xJEJsJJ<JJ -êJJ <$JM-ߪJE%J-JJ- JJs(JUJ -:JJ >$J*J-QJM-J.JsJ3J>JM-JRJsWKJsJ1Js=JVJncJuJnWKJMJJsJJsJJsJ J-WK J-( J5 J-XK? J-M Ji J-v J J-@XK J-pXK J-XK J-XK J- J J- J !J-XK!J-&!JD!J- YKR!J-b!J|!J-HYK!J-!J!J-YK!J-( J!J-YK!J-YKM-=JPJBsJ^JAs`JgJDsJqJCsJHHHHHHzHzHzHzHzHHHzHzHzHzHzHzHHHHHzHzHzHzHzHzHzHHHzHzHHHzHzHzHzHzH@HzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHzHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH M-_KM-&J8J-=JXJs@JJ-8=L*JshlKM-NJHJ <x=L)J<x=L)J/=L)J:=L)J-=L)J-(>L)J-h>LiJ <>LȫJ <>L"J -?LЫJ -`?LM-JRJsWKJsJ1Js=JVJncJuJnWKJMJJsJJsJJsJ J-WK J-( J5 J-XK? J-M Ji J-v J J-@XK J-pXK J-XK J-XK J- J J- J !J-XK!J-&!JD!J- YKR!J-b!J|!J-HYK!J-!J!J-YK!J-( J!J-YK!J-YKJsJM-=JPJBsJ^JAs`JgJDsJqJCsJM-{JJ?LHШHPH@H(HHHHЩHHHPH@H0HM-&J8J-=JM-J9J -]JkJ-mJ/J-}J8J-JJ-JʬJ-̬JJ-?Lc0J-J6 J -JJ -J/J -3JM-&J8J-=JJ<HHLJ sHL J-HLJ&-HL{fJ- IL J?sPILJfJJsILJsILVJsˮJJE`KJ>5J[&JfIL2JC-(JLJ5-XJLM-JL*J'-JL!Js(JخJsJL,J,-KLJ9-JkJ"-JJ/-J,J0-,JEJ--(KL J*-KJJ+-,J*JshlK\J -bJO,J(-XKLzJ(-JJ=-KLJ)-JկJ>-KLJFsKLJ<-LLJ!-JJ.-XLL,pJ%-xLL2J$-jqJM-LLJ1MLLMLLJ2s ML(J3s@ML3J4s`MLM-;JoJsMLXJ#-ML JEsJ4JFsJTJ nMLdJD-0NLsJsXNL~JsNLJsJJ<NLJ;-NLYJ <@OLJ spOLJ sOL&-J@-OLJA-PLM-JNJ<@PLȰJFxPLoJsPLϰJEPLٰJsQLJ:-@QLM-xQLJ6-QLJsQLJ7- J'JsQL0J8-RL:JsXRLM-J.JsJ3J>JXJBs@JM-=JPJBsJ^JAs`JgJDsJqJCsJlhlHll(llkjPnmmPnn(nhm(npqqqHpp        `Happ_http_get_asn1load_index                                                         , < L      \l      |                                LLLLLLLLLLLLLLLLLt LL,LLLLLLLLLLLLLLLLLLLLLt LL,LLLLLLL,,++l+4++***<(t*T*4**))))t)T)4))(((((l(,*5T4T4T4T4T4T4T4T4T4T4T4T4T4T4T4T4T45T4T4T455T4T4T4T4T4T444T4T4T4T4T4T4<4T4T4T4T4T4T4T4T4T4T4T45T45T4T45T4T4T4T4T45T44T44T4T4T4T45-P-S-M-H>>>>>>>>>>>>>>>>>>>L>AATBAAAAAA\CBAA\CBAAAAAAAAAAAAAAAAAAAAAAAAAAAA4BBBABBBBBB4CBBB4CBBBBBBBBBBBBBBBBBBBBBBBBBBBBBABB@BBBBBBBTABBBTABBBBBBBBBBBBBBBBBBBBBBBBBBBBBZZZZ$[D[t[Z.+* zRx DXsAC DEEH B | D Z F | D <dNAC DED E x H x H ,AC DEEH H $puAC Ep G t ,AC Cu D g ,,HAC BED4 E ,\tAC BEEDc I o ,AC FEHn K 4qAC BEGH D f J , AC Ce D V J ,$pAC Ce D X H $TpAC BDt B $|pAC BDt B ,PAC C} D F B ,AC C} D F B ,AC Ce D X H ,4@AC Ce D X H ,dAC Ce D X H ,AC BEED E v $@XAC A^ E ,xAC Ab I t D $XAC A^ E $D AC C D $loAC BD` ,@& AH P F ,@AG BEEF- I ,WAC BEHZ C f ,$ mAG P J ,T`,AC BGO= G ,@.=AC FF A ,P/AC HKM D 4@2q8AL BEEHDl G j44j AC BEEED A lhqpq$xqAC BD^ H ,qAC BEHM H G 4prrAC IW D Y G  J ,,sAC DGD D ,\XvNAC M H $xxAC Eb E  , y-AC IC H U C , zAC FF G ,}7AC Kv K 4D~AH  P Z F Y G ,|+ AC DL H ,dAC HD? A ,ȸ)AE HD E 4 D3AC DH H $D :AC BGl ,l 8AC BEEEH G , AC DL J , xAC DHJ , }AC DMV E L ,, H7AC HD D 4\ OW AC BEEED2 E 4 ]AH BEEHD E < bAC DEF M q O  E 4 xgAC DJDY A  L ,D @h/AC DGHR G ,t @jAC BID D 4 mAC BIIx H $ AH I K 4 pn AH BEHHDp D 4< AC BEHED H 4t @AH BEHED J 4 ș AC BEEHD H 4 \ AH BEHED I 4 HAC BHED A C E ,T 0AC DDg E f J , аAH HD F , 0`AC BEHJv E $ `AC BD} I , AC DEMT B ,<h7 AC FF J $lx)AH JV G ,vAH G_ A 4AC DEGDk E h ,X]AC BHHDB ,,AE BEMED] 4\AC HD+ E 4AC BEEED  D 4hAC Mg H \ D [ ,0 AC HD  E ,4AC HD B 4d` AH DDd K  J ,AC DEEKe F 4hAH BEEED H $-AC BD^ $,AJ BP B TAL F $t=AC BDn 4 AC G H V J $=AC BDn ,AH G H V $,x=AC BDn ,TAH G H V ,0;AC HH# I $@=AC BDn 4X AC G H V J $0 =AC BDn 4<H AH Mp J \ $t!=AC BDn 4!AH Mp J \ $p#=AC BDn ,#AH I J $,X%=AC BDn $Tp%=AC BDn 4|%AH BJs H \ 'AP K ,'}AC BI\ E p H $`'=AC BDn 4,x'AH BJs H \ $d)=AC BDn 4)AH BJs H \ $*=AC BDn 4*AH BJs H \ ,$@,CAH G H V $T`-=AC BDn ,|x-yAC DDs A t 4-AC DHd D ` 40.AK BD{ K D D [ 4.AC DHd D ` 4T/AC DHd D ` 4h/AC DHg I Q 4/AC DHd D ` 480AC DHd D ` 440AC DHd D ` 4l1AC DHd D ` 4p1AC DHg I Q 41AC DHd D ` 4@2AC DHd D ` 4L2AC DHd D ` 43AC DHd D ` ,x3;AC BDP F V $3^AC Ad G ^ 43(AH BHEED E ,LH\AC DEEKe F ,|\7AH FEDt D ,bAH BID H ,e*AC FED G , XAC BEEF K <Tl ,)AC G D $OE E E$<AC FK,d-AH KU G ,=AC BGF I ,LAC BID G 4гAH BEEED D $,AC G| A ,TAF Y J ,rAC BEDJ G Q ,AC DH} C ,/AE DEJ ,AC FHD  E ,DAC BEEEDh 4tpAC BJ- C  4HAN BHEEDU D 4AC BEHq D \ D [ ,8QEF BGDm K4LhAC BEEHD@ D ,0P AH BEEFn G 4Pi AC BHEED C 4AH BEEED K L$ AL m F Y G G I J F J F D L G I G ,t ` AC BMEER K 4 pAC BHHHD5 I 4 *AH BEEEGC D ,!-AH BHGD I D!`3\!X3 ,t!P3AF FHD G ,! 6<AC HL A ,!07 AC Iw A ,"ADAH BF G 4"CL"Cd"C|"C"C"C"C<"CAC BEEED' H  F 4#HF:AC BEEHD D 4T# AC BEHED J 4#XZAH BHHEG I $#AE I G $#XAC BG A ,$AC FEDH E ,D$6AC DEED G ,t$ИAC BEEED J <$IAC M E c E c A ,$AC DEJ D ,%p AC FEDA D 4D%AC BFS A A G ,|%xxAE DDE E _ ,%ȨeAC FED H % % $ & AG DD ,4&`AC BEEEHx K ,d&=AC EJ E ,&AC FJK K ,&&1AH P E ,&5AH BNa F ,$'@:nAC DH C ,T'@/AE DGH K ,'AAC BEED J ,'DSAC FED^ G 4'0EAC BGHDf A S (EJAO At ,<(EAF Q A ,l(FAC K A ,(8GAH DM C ,(HAC BEGD G 4(xJ3AC HD D ,4)~AC BEEH E 4d) AC BEEED D ,) AH BEEED J 4)hAH BEEEG E $*4AC BGf 4,*AC HD F d*AM F $*wAC DGg $*XAC C A $*AC C H $*xAC E A ,$+AC BJz ,T+`AC FJ D ,+ AC BN G ,+гAG BL F ,+ AC DK C ,,\AC I B ,D,жAC FI F ,t,AC FI G ,,pAC DL A ,,`7AC I G ,-pAC BHp B Q ,4-AC M A ,d-AC FJD A ,-AC Gw F O $-=AC BDn $-=AC BDn ,.AC BID J $D.`cAM AO $l.dAN AO $.dAN AO $.8`AC BJO ,.pYAC P F ,/AC FEK H ,D/PAC FF H ,t/AC FEK H ,/AC FF H ,/AC DL G ,0PAC FF H ,40AC FEK~ H ,d0AC FF H ,0pAC DH G o ,0AC I C 0$ 1AC I J 41PL1H d1@ |18 10 1( 1 1 1  2 4$2AC DHd D ` 4\2hAC DHd D ` $2UAC BH B 222,3AC MX G ,43AW KEED2 E 4d33AH BEEHD G 43AC BJLEK B ,30AC BELEP D $4AC Ii J 4,4(AC FD C c E 4d4-AH BHEEDZ E ,4 AC BEK K ,4qAC BID G 448 AC BEEED G 45,L5xAC DEEG  J ,|5XVAC BM G ,5AC BHHW C L ,5AC HDD D , 6#AC FHHA E ,<6AC BP9 A ,l6hAC HD E ,68AH BEEED B ,6AC DGh I a ,6h86AC HD% K ,7x) D7p)\7h),t7`)vAC EU B D D ,7)AC P D $7,AJ A| H 7-,8-`AC BF E O D8.$AQ F ,d8 .AC At G i G ,8.AI Kd G 8@1,881AJ Cn D q , 91XAC HG A $<92tAC AJ A ,d9P3AC W E _ Q T ,93AH FT I ,9p5AH FT I 97  :76$:07 <:(7,T:07AC BGEDr H 4:7<AC M O  E ,:9#AC FF G ::4;:AF BEHk G y G \ D <;;T;;l;;,;;[AC BEDt E R ,;;XAC BEEDn F O ,;<AC DEH^ E 4<<AL Gp D m K $L<=1FC AWA $t<=9FC AYK <=AC H,<h>jAH BLHZ G i 4<>AC BD G @ H I $= ?,<=(?cFJ Au J H Hl=h? AM Q ,=h?aAC BDg G h ,=?AC BDg G d D 4=@aC DEI B4$>@AC BEF[ L ~ J h $\>AEAC BDv ,>AAE FLDC I ,>BWAE DGOH O ,>CAC BEEEHr A ?@F ,?8F,D?0FAC DEED A ,t?GAC DEEK G 4?IAC BHR H [ E ,?IAC BEEM G $ @HKAX Ae A  ,4@LAC DGDL A ,d@MAC DEEK D $@`PQFC ArH @P5,@PAC BN H ,APT\AC FM B ,4AUAH BTX A ,dAUUAC M A ,AWgAC G) D j 4A@XAC DEG J n A <AYSJC BEEED A P $Y\ H Rȳ R< SAC FEK G N B  LS($dSJAC As H I Sȵ2AC m SFP ] ESHS@4S8 AC DDJ J  H $4T|AC E F 4\THAC BEHN G W A j ,TPAC BG[ H _ $TAC GG F 4TAC BEHN G W A j ,$U PAC BG[ H _ $TU@*AE Q I I 4|UHAC DEDB E I ,UAC BEHt I K ,U0AC FEHs F $VAC BHK G  E> >4,AdBB>B&>B6>BF>BV>Bf>Bv>B>B>B>B>B>B>B>B>B?B?B&?B6?BF?BV?Bf?Bv?B?B?B?B?B?B?B?B?B@B@B&@B6@BF@BV@Bf@Bv@B@B@B@B@B@B@B@B@BABAB&AB6ABFABVABfABvABABABABABABABABABBBBB&BB6BBFBBVBBfBBvBBBBBBBBBBBBBBBBBBCBCB&CB6CBFCBVCBfCBvCBCBCBCBCBCBCBCBCBDBDB&DB6DBFDBVDBfDBvDBDBDBDBDBDBDBDBDBEBEB&EB6EBFEBVEBfEBvEBEBEBEBEBEBEBEBEBFBFB&FB6FBFFBVFBfFBvFBFBFBFBFBFBFBFBFBGBGB&GB6GBFGBVGBfGBvGBGBGBGBGBGBGBGBGBHBHB&HB6HBFHBVHBfHBvHBHBHBHBHBHBHBHBHBIBIB&IB6IBFIBVIBfIBvIBIBIBIBIBIBIBIBIBJBJB&JB6JBFJBVJBfJBvJBJBJBJBJBJBJBJBJBKBKB&KB6KBFKBVKBfKBvKBKBKBKBKBKBKBKBKBLBLB&LB6LBFLBVLBfLBvLBLBLBLBLBLBLBLBLBMBMB&MB6MBFMBVMBfMBvMBMBMBMBMBMBMBMBMBNBNB&NB6NBFNBVNBfNBvNBNBNBNBNBNBNBNBNBOBOB&OB6OBFOBVOBfOBvOBOBOBOBOBOBOBOBOBPBPB&PB6PBFPBVPBfPBvPBPBPBPBPBPBPBPBPBQBQB&QB6QBFQBVQBfQBvQBQBQBQBQBQBQBQBQBRBRB&RB6RBFRBVRBfRBvRBRBRBRBRBRBRBRBRBSBSB&SB6SBFSBVSBfSBvSBSBSBSBSBSBSBSBSBTBTB&TB6TBFTBVTBfTBvTBTBTBTBTBTBTBTBTBUBUB&UB6UBFUBVUBfUBvUBUBUBUBUBUBUBUBUBVBVB&VB6VBFVBVVBfVBvVBVBVBVBVBVBVBVBVBWBWB&WB6WBFWBVWBfWBvWBWBWBWBWBWBWBWBWBXBXB&XB6XBFXBVXBfXBvXBXBXBXBXBXBXBXBXBYBYB&YB6YBFYBVYBfYBvYBYBYBYBYBYBYBYBYBZBZB&ZB6ZBFZBVZBfZBvZBZBZBZBZBZBZBZBZB[B[B&[B6[BF[BV[Bf[Bv[B[B[B[B[B[B[B[B[B\B\B&\B6\BF\BV\Bf\Bv\B\B\B\B\B\B\B\B\B]B]B&]B6]BF]BV]Bf]Bv]B]B]B]B]B]B]B]B]B^B^B&^B6^BF^BV^Bf^Bv^B^B^B^B^B^B^B^B^B_B_B&_B6_BF_BV_Bf_Bv_B_B_B_B_B_B_B_B_B`B`B&`B6`BF`BV`Bf`Bv`B`B`B`B`B`B`B`B`BaBaB&aB6aBFaBVaBfaBvaBaBaBaBaBaBaBaBaBbBbB&bB6bBFbBVbBfbBvbBbBbBbBbBbBbBbBbBcBcB&cB6cBFcBVcBfcBvcBcBcBcBcBcBcBcBcBdBdB&dB6dBFdBVdBfdBvdBdBdBdBdBdBdBdBdBeBeB&eB6eBFeBVeBfeBveBeBeBeBeBeBeBeBeBfBfB&fB6fBFfBVfBffBvfBfBfBfBfBfBfBfBfBgBgB&gB6gBFgBVgBfgBvgBgBgBgBgBgBgBgBgBhBhB&hB6hBFhBVhBfhBvhBhBhBhBhBhBhBhBhBiBiB&iB6iBFiBViBfiBviBiBiBiBiBiBiBiBiBjBjB&jB6jBFjBVjBfjBvjBjBjBjBjBjBjBjBjBkBkB&kB6kBFkBVkBfkBvkBkBkBkBkBkBkBkBkBlBlB&lB6lBFlBVlBflBvlBlBlBlBlBlBlBlBlBmBmB&mB6mBFmBVmBfmBvmBmBmBmBmBmBmBmBmBnBnB&nB6nBFnBVnBfnBvnBnBnBnBnBnBnBnBnBoBoB&oB6oBFoBVoBfoBvoBoBoBoBoBoBoBoB!J!J!J54JA4JJ4JW4Jb4J54JA4JJ4JW4Jb4JW@J8J54JA4JJ4JW4Jb4J2dJpB@pL* JBsLw8JPB zL!J0nC LeJCLeJCLeJPCLeJ`C@LeJDLeJDL0JP"D`L4J)DLeJ2DLfJ@D`LXJ@_DL fJlDLfJvDLfJDL$fJЎD L,fJDL8J2ELJ`DLwdJТDLr/JpDLLJD L3fJ0EL8fJPE@L=fJ`SELDfJiELKfJPELQfJPELWfJE L\fJELffJE@LnfJEL.JE@LtfJpEM{fJEM .J&F MfJ2F MffJfJfJQFMfJF'MfJ+G btơu%]oO4~o0o٠]\ A2 ¢~h\(!XcLNKMX\Ug}n To@gL[<zgi @v&CV(_;i6,Qw/W{b;@{h 8!]F#rQFyٽ,W~={k&'jw,B҈ӒQd\lG %??! ]Te}ðhϛGjZ 7dy=a!t]LQG\LzrSxH:џ}G{tPVW+AV8F NDC!]n&1 !Ľ$PH,.I_W'6 +٘4PXTctvR{(JN؜y؛f/ϬyEx~"Qg&#8pMO@~rR332g蠋kE vϑMLoPF%ho0i](Hޙ?_ s$ ]*?'b{tbSa'z MTXItU~#Za~qM4)h^ lAsj~21lՅePfeo?nAj)}G0 j3=S.Ys>u1GzR٦{8h~KS[Yqenfk6(ץ,9&Kښp7V#^9OCeòp[PI(1gPޛ~, Pa孽6N@} K}!ڻbG6g茪8a>ʼns;lIǟ D0پ[_׉t),TQޠ/$kwޢhR SP@1VSz"Iqi&+pSFbP3K$ ke8`$ԜLz"0!?܌`0&9>dQ'^v͆3;<~ w"0qt035V4Go;X ܏pAzҚ5 W wTt>O|Lfέ=P!mĮ8bl ي] {1;VhU t WmNXOXWt|K]DX .Lr"]+-`V+!9X7ʣwn3m_3.4B_ <'~݇UiUzq]:xC)I^yG.c礋TD]c,~e% O:J褃Ix߬,7>yU؜l[z[[us'y(EX#l)PQ8L5{0^t?.3tu Oeo7ͶoP^}ֻ@Ն&A>s*M\-j(uL#,re<%? Nnzzy0 -d tHN5PD0Jmk.5R&7 o{@bo]/; hitCJrl.4^v>EJzg81{T Xٔ]^PkW*];)!AG UMp⊊#6)TfX }]lHS+G4>?VCeZp>b?[P]gb)m]W 2j5](Ą%c>0WE4:wa=J]yK/%(iw|Ju.+P2COw" iX 5maJenbj9 ANHs/U7kE.&c"^ͮbN-iOA~6)Y7d@2&0`nԳD3LJǒB6>tcY 6E+6^ʫIӫc W<I]^#8 "]V2nic'NXpNl^jCElf\}\xU3K<;XyjSiWq[BI薀H|t~kT75{9O.ev XWn?L-F(:H峄GXŬ#͖^A{KS ImQم:b1\nM{QY\̭˓iqc3;#z=ok[ښٕv8ӽJpM‘MT,ߪw(*,|& QMvvEOvq,T ouMʓH0J%/I25 IBљ#*!Q'*I ϞD'A W6\~t+_j3,*'Wj@OL:].꽂^Cqշx:D&eSVODUG?B߼ iT[|IϿBOd儇 p%8ӴxO?NKsz{w,å12U5wbFa00ࢌ)D_MR("6eT_- Nۤ/7A)G7Z?AIWΠ??FtS0Mnrsy`.*}|MD؊P):)ٯ:G]33[J_[88^΁DfbdOv#ak÷3cx2; Xꭼw1Y% .b\hv#E P?Þ;TU2tF,~` {9Z qE9MڍDH1%GۘVfHLl,TCvvh oՓʛ0a ʙ/fVJ.4U+J|gmk[́\:6zдW&e=;<IJM1^O=f"}Ư<>oz/̍"(%ԔӪЅo Ur >4, E'/U>xx.әl?v:0v0JPXԹ4BNGTEeKЅS~Y Wj؟w@c!uv'A0_Ƥ0S6.ٕ)F`'o>1*N|.AO#!MtD9iK.v^De1 ,g=.ӗTES|?ɬ kr$BCR-Ӊ(vUg9ٷ jQz:;A[]3hSdÊFDloEg<"Gzy znS옂W8U:Mr7J6T?g׸nO`+Z Q30F&8ɗ2-Y8ffN{c?ҭB) (YX}\C~ c-a3QFCNa(epC!v{@'>kwmΚw١@k!ܖrϕ^%`9Tlu88MB%f V&MXqjܐ6nC,NfcHо$#.0;/3x n3' 71MC̠I-7Ӑ_1iK석+ݛX((Tl% OG®/m)=(CLyYuwVCڬBʕs&T:7d1@YrMa!BLx1|{jT8T/ڟyBʺ!+JN5=Ů'0E;C>5 S2+]XҫSeIHM]`EJ`+7c XC~ܡV^i0~v_Xϻn2Ho|ȏӆ"Iܒ Mvg@[TfHYU;췈0rBe⑧ERQ25#< ճy[Gֽ!i,cnʄ02-I*@|E6G~.[v쉌%w۔"ѩc۴CN/hP /[Kcz0.e(왡ztTЯXNP~1 ם0&0HXTZ l8y9/^!y92rɐί &_.^f/}"mh>nēB dR\ AxRv?k "r{C &&Pzɡʨ,W>PEz,Y{4谞'Ż0'ۤ7dȆLdNL{̠q4HF7ΰM9/|ϐ[7(BY5Fn)zwg+6ׁ]8hI}<60z!u`>BGI\i}<5lcbaa\bb #l=,Kr'6e8WjOQА#e<,0Z8byK ?_F&[(MߓŔKB5kiav 3 KˑzGyW= InF:˴[0% 6Z1scnTSiT؄р W&Ed+E7W0.]tRރsa!b0l6Q{QI'ݽy9=emR`ȋ3׾CM+FTDRdGlJd?!/r|&߀PԔ}qدt63XcseD %ݘݼ ,CA¡7pZj06!i>8M4G~&%&NUMJYd~r}}+,܋R V&yq Y'h=6Uwi?cp!7бWzc V;YljT-x}N [b; $N=Z>=83^7L+X%X#ƃx݉ nk7tڠZ+( Pd~(;&9VrMg7,n1Yx]'E1!ά~2v1ĺZɞt&nmC b4IʓBK#yXfܫ3"+\{.RrxJISv-.C<9ta3*UJ痦@ARfϿMɾcv58y#H`8_kg[A ^KN[Gb#ٶ.]l|U Ϭ7jO@yJy&5M>9l9_RT$|n>J@lcDRSQG.N :&S ũ֊)uͶ{d|~ HJtLS={jw/,yD7;=)ˉdKWk '/= <s}pieKtI!d3P3b[ rQ2:dsh[p\gE`W+G "sV3> !+nk ݵI6옘 ~gjz Q͡mTi j^ \g-f3"X陯 *Vm@7gzT[r֥#9xȃtyž =4D+"G1ke__]Sp7M|Jуܲ=xX9P-D#6_ߞO㌿>IyXG/!c2culnhHY4C Tg!8 @..JQݺ#f*ʜl-k}hRV/U) N] +֛Ҙ)E\UeͬSFߥX|.FF/֪!~vb; 6yUd*N;D|N7&xm$kH!g"@?զ^MUq–%GDoS+wf~z(e1ׇ)[tQ{Ѝrw oI~$2pYp}Ėa; 츜 w'5fF1jR] ,4zj!B1H'y{QK[jqE07ޢh -Zݑc_yڙ :KCpWĶύ*#o_J'2$d,9/K~e\nĶ+Q.`ug+vAB)ʷa: odqembvmkx"2cS}흂,\݅Ҭn`.vʱrP[9|ioIRg#C,|;ea޵cslp,s쇒 g֜5HH;DsY{vM[/_)n7֪O^R0 'FezC!Ipч)6f-{ 8َx'ϵEX=!Rhax(l_\=A. _5P3},;$15sƘxf1ͦ _Y:5T!j+qf;AR2RQU2O;+amhy4IC|N^1 $"5̢ [eqd>3NAT2x~OFjx?_g LQQJXd٢2T68 `2jGA;~Ŧ3gl~Ô,,iN{@M*'Z-?}QpP8M6y.+}/J ޑǯ흸le^gb:gWVJXnp)hEͥD V&ХIn"{X:RL\|{2Nd%k}v"S1kץk8 '3󚮔 m'U)?&T#<\.!#%.oT{ka Qﻹf,%v˿z/V3ّ1rJ!BNl'"峣瀻Rdf%o ;6.+OƱ[ {5-D>DG&q{mK,l!ΓI4iI>q[~^T<) Ƥax~ 국h ')|p* 9vr0^JUF_a%z=o+Ij¡ 1BCN||`貐! |cn[i=w;&'*ܕOB m 1!8\yAt (R/M0ŦaBOfc5-;q% F⧣ͿX%_ *FKfrQ6Rq!O+&PL|.Tv%H9o$dcDol?/xӷ&ۍ7M\åuLoXU2n+EH@ع<s[qw?o6Q_~PzM֣v$_[\dq6a'}}՜ZTUE-XR(eRE+alY{땁)R25ʑ2bwC,Ax'P."볥' &~9r"cyjUaA7)RN1D.A  ·bh'[ZzKs@xB(^qzx>,9r,]Ǯ)ha7}} GhFVm{Q{5 z*CH#ma@c+/aLp=xO 5mm79}3TӃe}':k悎X-8l;GXpMF4` <@2u#lWs L\~Nus-TUɼ˷Nj }Ј!C s}T}c^' n~Z M9;|s9Z}r2XqnfY֬S-FX.M}JLWTY,m=*)`DSԩ~!n^SY7qpc*)ךvGN1O*ejKCy8A65E<6Hw teThD,͇;) rLTfA=>_/Xh1WuM8}V4+@|"&}W(8qy!BRfJnGպ7|ocDݱ0mͿ4'Y}yܖ[N@k:dp$\t^gJʾNH}YbPSF[Z=spYk^*jN#8ֳ q-ܥ3ݢ>XSnx5xCcut q$aSM9 "/ԙt:cLZZo)3P'grcȈKջv۱כoz\,`. m+yF$\2T/xs u#Y[$u/R! %]OEʠTo"Ͻ#􏙧g;I5O76u% l>-29K__n~Qٳ7@}rS-~`I1Le:Mc!xk@[Iu#;ŀ`'zwK>uC&qrprp%j-yeN}\[7CfHlgdu6%Ut,(v= jZc>1)~3K(-:Q&.)G]c)emxc1rTsr&HWW('b1XzrnEg&%dE186FNq_ AȔs0Tv#"zB2Fy zy=2b)s Q#>t$ `6*(M憘|!3T O|mcs* 8Q#7f?Gos!ktOš2n2Bz=yCzC FxMg)+_pJjZ¬ǭ b,?VPr*؄1c' ^x1Kw\P7fkT]nX TF~ !1^ g2V XVB5ld ?f_>9]2Hle4P[.y b5ohiH]4ArZqGo@@pc6;)0 )qC;QWq+e!S_()O|D(AOj(P9gS,<˖A@2pe:"yj̙r}m䐵pNH`*z=$)ڽפ`-"ek(/y|CBjEO.4T}my.QMyVD7ZHH?,QFAƑrUs,tP:/mwmE i'e^4Ӂ=0C#Bv1sFa 9@zۀ, 4ԒlnOϯLwvrGќJ3nuv1w)R.R0u ͉ lW'=/\v)K xraao9N>Ǐ68%zJԠ>!9r=P]_?mU ![&+wOv,"j办VxD^`ey1#.t॔KXU346Wy.;N!\HJ`)S--o B.q1mo+#ߴ@, }}Kߑk iif[F}pm~uNwMA?bq^8K,0oI.ɚ] U:%#Вã/MUZ1u,A_uc,h˓QsI`&FP_YT͘At_ `{< 뤓ʚ'e[yn&(;smSX`\vCX$; $ET7c}t!HĔD"-->Z1ܕAX@_ڬ?*kX_Hx $< %kBl61z&v jb |I wgG!?C!F0bQrHg͞!0A4w>9g*{/@pO? vJ5NG+]tC3{I@fbz˓SԀH'KAa߿=q %qJWl!}5EjC\T_$.@ޒ#YҡL e[·Uq< $ka3B+wtyyϭW5 tqXk2]vH9#wJp>lR$ AZz^15uĖt۴Ȍ;fPGeb4X5j,Zhxdk>Nz¶vœjiV4J n5`#0d9`vQJ<:, `iJ!IT X!QG>TFٶdT/ϥ(9v[-C$oio}_x@ (eƞVpRҔJ%L.y\ՎTU%vcP"/XXykAg&lWa:}1-8b6BB$ge |oDɫLE{80X+] TIM"@P.x(x$V—,Cfr_S챱^@ H{?j!5GŊO^c`q[JO`ƺJ$ .:΍'! QU0c׍ąN'|.墣Lc9wfʠqP=5.`haCʚ#JEraww*-Va^jFJ?PֺוeSánCӁFFHNy@4q^J^Op-=:ը  9_!1trkd5a 9!f |ʡZqT(pCl{hMEF C,FN&.۰U*PD!0;#3ʣLR6?` Q qw:0!=$.:%Bjhyi.˹-Q5˾_XT0wP/W Bʅ sG 9b?g]$`)L='jPF<#9Zb?J^ISuC)"Ń Wm"$+Kg7ۏ8CD?LS.=fL=1lߖ3#GYu)wԐ ?LէA󀎱c?+sսQjȺMT8Шu"aQcOшI0G0\u؉EQ!o0o3$  (#kL:%OyO9]_4T@LZE ߡjpwFD+u2l'i\sGd+B/,i'ѵ#Ņ-CMIt~$ϜE@*(@)ɰ#~2Ƀѝ>շ}ec]]ύ p *q}ǸbpJO6%jF߾wVm%_[7̹J3cCCC@)|+6S} MRt_!\:Z%!vL|qPq'[# ![(=%*-}x~ $*\*hoVs:N#"jtx?DwQ0>|I ˊf$3;@VP澄 %Ӝlb]+}=zlTQ [GdUZ7%}!ioɊ@zp NFz۳˃#ĽԪ]1FΞugSGD%s~ЎYѲZ/9ͣ¹ǹHƘMʄl)Y5dY!3kQ^޸_ƹ"eFD#33kYtj>6P!Бl/&0ej0VboVqIZM4Xy0UlZL,YV蝯 xQUC;l -A(Пj~ Ы|}5'IQcd>amS9'Ogw:o s>z(a#+΄W~%Te̕ 0YakNCy% Hh f+vFNY LeHxC,$}ZpEl)@?[GD9rzڪ* T#7[a ~$sm@r HlF9OxFj1d 8<*+16`-t2蜓n{q%8*7Dΐ?RR"8v iXj}|,2O 7C]$'FTSbq+qAu:a)F:ck0N% U˃uk4A)jUMp쮇8 EwnW`W"ˏ3:7o림Sp!v>/E$Y2.;#x=gO7NGL-OA.-",SU+?X:0ڰ-O&8=pQQy2{-'ŜyRS"絮nUe LsjI)aF X׈^{BXEA  1W=[/_OGV? )[Iz*!,IOQmKKR,JVJ 9L`9L9LJ9L:L8:Lp:L:LdJJ:L ;L`;L1lJ;JѾJDfJfJ XJ@վJܾJ*JJJ8JNJaJsJJJJJ J J JJ2JKJ]JoJJJJ JJJJ J@ JJ;JGJ9JߢJJXJ.J_JfJmJ$.Jm0JJwJJJJJJJJ JJ1JJJJ J *J EJSJeJUJdJrJJJJJJ J J JJ,J@JKJ\JpJJJJCJJJJ JJJ*JAJ(TJ*eJ+~J,J-J.J/J0J1J2J3J<JF.JGEJPUJVmJZ|JdJmJnJoJpmLqJrJsJt-J5J=JEJMJUJ^JmJvJJJJ@JAJBJJCGCC: (GNU) 3.4.6 20060404 (Red Hat 3.4.6-11)GCC: (GNU) 3.4.6 20060404 (Red Hat 3.4.6-11)GCC: 8.2.0GCC: (GNU) 3.4.6 20060404 (Red Hat 3.4.6-11) GNUgold 1.16openssl.pdbD>.shstrtab.interp.note.ABI-tag.note.gnu.build-id.dynsym.dynstr.gnu.hash.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame.eh_frame_hdr.data.rel.ro.local.ctors.dtors.dynamic.got.got.plt.data.tm_clone_table.bss.comment.note.gnu.gold-version.gnu_debuglink 8@8T@T !t@t$4 @<@@@-Dop+Ap+xH,A,*NoWAWN [odAd0j(fA(ftBfAf~ByBjoBoJ  J  s} pM lapM N   N  N  N N HN 5EN5 }  N  N H   #Բ2